BLASTX nr result
ID: Achyranthes22_contig00018628
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes22_contig00018628 (337 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002527513.1| conserved hypothetical protein [Ricinus comm... 63 4e-08 ref|XP_006605999.1| PREDICTED: uncharacterized protein LOC102662... 60 4e-07 ref|NP_001237385.1| uncharacterized protein LOC100306091 [Glycin... 59 9e-07 gb|ESW15111.1| hypothetical protein PHAVU_007G045200g [Phaseolus... 57 2e-06 ref|XP_002527514.1| conserved hypothetical protein [Ricinus comm... 56 4e-06 ref|XP_002300267.1| hypothetical protein POPTR_0001s30200g [Popu... 56 6e-06 ref|XP_003631687.1| PREDICTED: uncharacterized protein LOC100854... 55 1e-05 >ref|XP_002527513.1| conserved hypothetical protein [Ricinus communis] gi|223533153|gb|EEF34911.1| conserved hypothetical protein [Ricinus communis] Length = 197 Score = 63.2 bits (152), Expect = 4e-08 Identities = 36/96 (37%), Positives = 56/96 (58%), Gaps = 3/96 (3%) Frame = -1 Query: 337 LIPYLVRTIKRQNLHKNSYYRCLSNGSR--HNLLATAGDSFNGSSHRRTQSQFQAPT-SL 167 LIPY++ IK+Q H+ Y+ S GS ++LL +GDS NGSSHRRT+S+FQ P L Sbjct: 4 LIPYILHAIKKQRPHRT--YKSFSEGSSRSYHLLIGSGDSINGSSHRRTRSEFQPPAMEL 61 Query: 166 DSHHEVDQFVRSRSMKSITIQNRQINHNNNTHASAY 59 ++VRS S++ ++ + + + +AY Sbjct: 62 LEQRSALEYVRSSSLRKRSVNSPTVASESKFGTTAY 97 >ref|XP_006605999.1| PREDICTED: uncharacterized protein LOC102662455 [Glycine max] Length = 108 Score = 59.7 bits (143), Expect = 4e-07 Identities = 41/99 (41%), Positives = 55/99 (55%), Gaps = 12/99 (12%) Frame = -1 Query: 337 LIPYLVRTIKRQNLHKNSY----YRCLSNGSRHNLLATAGDSFNGSSHRRTQSQFQAPTS 170 LIPYL+ IK+Q H ++Y + SN S H LLA+ +SF GSSHRRT+S FQ PTS Sbjct: 4 LIPYLIHAIKKQKPHHHNYRSYSHSESSNRSYHVLLAS--ESFTGSSHRRTRSDFQPPTS 61 Query: 169 --LDSHHEVDQFVRS------RSMKSITIQNRQINHNNN 77 L+ + VD F+ S + T+ H+NN Sbjct: 62 EFLEQRYGVDGFLVSPRGQFTAAAPPPTVNVNAAQHSNN 100 >ref|NP_001237385.1| uncharacterized protein LOC100306091 [Glycine max] gi|255627517|gb|ACU14103.1| unknown [Glycine max] Length = 108 Score = 58.5 bits (140), Expect = 9e-07 Identities = 37/75 (49%), Positives = 47/75 (62%), Gaps = 6/75 (8%) Frame = -1 Query: 337 LIPYLVRTIKRQNLHKNSY----YRCLSNGSRHNLLATAGDSFNGSSHRRTQSQFQAPTS 170 LIPYL+ IK+Q H ++Y + SN S H LLA+ +SF GSSHRRT S FQ PTS Sbjct: 4 LIPYLIHAIKKQKPHHHNYRSYSHSESSNRSYHMLLAS--ESFTGSSHRRTGSDFQPPTS 61 Query: 169 --LDSHHEVDQFVRS 131 L+ + VD F+ S Sbjct: 62 EFLEQRYGVDGFLVS 76 >gb|ESW15111.1| hypothetical protein PHAVU_007G045200g [Phaseolus vulgaris] Length = 103 Score = 57.4 bits (137), Expect = 2e-06 Identities = 33/74 (44%), Positives = 43/74 (58%), Gaps = 5/74 (6%) Frame = -1 Query: 337 LIPYLVRTIKRQNLHKNSYYRCLSNG---SRHNLLATAGDSFNGSSHRRTQSQFQAPTS- 170 LIPYL+ +K+Q H + YR S+ +R L A DSF GSSHRRT+S FQ PTS Sbjct: 4 LIPYLIHAMKKQKPHAHRSYRSFSHSESSTRSYHLLLAADSFTGSSHRRTRSDFQPPTSE 63 Query: 169 -LDSHHEVDQFVRS 131 + H + F+ S Sbjct: 64 FSEQRHGAEGFLVS 77 >ref|XP_002527514.1| conserved hypothetical protein [Ricinus communis] gi|223533154|gb|EEF34912.1| conserved hypothetical protein [Ricinus communis] Length = 118 Score = 56.2 bits (134), Expect = 4e-06 Identities = 33/75 (44%), Positives = 47/75 (62%), Gaps = 1/75 (1%) Frame = -1 Query: 337 LIPYLVRTIKRQNLHKNSYYRCLSNGSRHNLLATAGDSFNGSSHRRTQSQFQAPT-SLDS 161 LIPYL+ I++Q +NSY SR L T DSF+GSSHRRT+S+FQ PT L Sbjct: 4 LIPYLLHAIRKQK-PQNSYRSFSVGSSRSYHLLTGADSFSGSSHRRTRSEFQPPTMELLD 62 Query: 160 HHEVDQFVRSRSMKS 116 + +++RS S+++ Sbjct: 63 QRQGLEYLRSGSLRN 77 >ref|XP_002300267.1| hypothetical protein POPTR_0001s30200g [Populus trichocarpa] gi|222847525|gb|EEE85072.1| hypothetical protein POPTR_0001s30200g [Populus trichocarpa] Length = 112 Score = 55.8 bits (133), Expect = 6e-06 Identities = 35/84 (41%), Positives = 53/84 (63%), Gaps = 5/84 (5%) Frame = -1 Query: 337 LIPYLVRTIKRQNLHKNSYYRCLSNGSRHN---LLATAGDSFNGSSHRRTQSQFQAP--T 173 LIP+L+ +IK+Q H + YR LS GS + L+ G+S NGSSHRRT+S +Q P Sbjct: 4 LIPFLLHSIKKQKPHNS--YRSLSMGSSRSYRLLMGGEGESVNGSSHRRTRSDYQPPPME 61 Query: 172 SLDSHHEVDQFVRSRSMKSITIQN 101 SL+ +D F+RS S++ ++ + Sbjct: 62 SLELRANLD-FLRSGSLRKRSVNS 84 >ref|XP_003631687.1| PREDICTED: uncharacterized protein LOC100854891 [Vitis vinifera] Length = 104 Score = 55.1 bits (131), Expect = 1e-05 Identities = 31/55 (56%), Positives = 36/55 (65%), Gaps = 1/55 (1%) Frame = -1 Query: 337 LIPYLVRTIKRQNLHKNSYYRCLSNGSRHNLLATAG-DSFNGSSHRRTQSQFQAP 176 LIP+L IK + H S YRCLS GS AG DS +GSSHRRT+S+FQAP Sbjct: 4 LIPFLFNAIKSKKAH--SGYRCLSEGSSRGYRLLAGPDSSHGSSHRRTRSEFQAP 56