BLASTX nr result
ID: Achyranthes22_contig00018537
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes22_contig00018537 (282 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006402369.1| hypothetical protein EUTSA_v10006249mg [Eutr... 85 9e-15 ref|XP_006292743.1| hypothetical protein CARUB_v10018989mg [Caps... 85 9e-15 ref|XP_002876677.1| Os01g0254000 [Arabidopsis lyrata subsp. lyra... 85 9e-15 ref|NP_191815.1| Ras-related small GTP-binding family protein [A... 85 9e-15 ref|XP_004135993.1| PREDICTED: GTP-binding protein SAR1A-like [C... 84 3e-14 ref|XP_002489085.1| hypothetical protein SORBIDRAFT_0111s002010 ... 82 7e-14 gb|EMJ27092.1| hypothetical protein PRUPE_ppa011849mg [Prunus pe... 82 1e-13 ref|XP_002512498.1| GTP-binding protein sar1, putative [Ricinus ... 82 1e-13 gb|EXB66050.1| GTP-binding protein [Morus notabilis] 81 2e-13 gb|EXB47146.1| GTP-binding protein [Morus notabilis] 81 2e-13 gb|EXB47144.1| GTP-binding protein [Morus notabilis] gi|58787697... 81 2e-13 ref|XP_006444474.1| hypothetical protein CICLE_v10022379mg [Citr... 81 2e-13 gb|EPS60431.1| hypothetical protein M569_14374 [Genlisea aurea] 81 2e-13 gb|EOX95241.1| Secretion-associated RAS super family 2 isoform 2... 81 2e-13 gb|EOX95240.1| Secretion-associated RAS super family 2 isoform 1... 81 2e-13 ref|XP_004300458.1| PREDICTED: GTP-binding protein SAR1A-like [F... 81 2e-13 ref|NP_001275076.1| GTP-binding protein SAR2-like [Solanum tuber... 81 2e-13 ref|XP_002275765.1| PREDICTED: GTP-binding protein SAR1A [Vitis ... 81 2e-13 ref|XP_002515297.1| GTP-binding protein sar1, putative [Ricinus ... 81 2e-13 ref|NP_001234640.1| GTP-binding protein SAR2 [Solanum lycopersic... 80 2e-13 >ref|XP_006402369.1| hypothetical protein EUTSA_v10006249mg [Eutrema salsugineum] gi|557103468|gb|ESQ43822.1| hypothetical protein EUTSA_v10006249mg [Eutrema salsugineum] Length = 193 Score = 85.1 bits (209), Expect = 9e-15 Identities = 39/42 (92%), Positives = 41/42 (97%) Frame = -3 Query: 280 TTGKGKVNLAGTNVRSLEVFMCSIVRKMGYGDGFKWVSQYIN 155 TTGKGKVNLAGTNVR LEVFMCSIVRKMGYG+GFKWVSQYI+ Sbjct: 152 TTGKGKVNLAGTNVRPLEVFMCSIVRKMGYGEGFKWVSQYID 193 >ref|XP_006292743.1| hypothetical protein CARUB_v10018989mg [Capsella rubella] gi|482561450|gb|EOA25641.1| hypothetical protein CARUB_v10018989mg [Capsella rubella] Length = 193 Score = 85.1 bits (209), Expect = 9e-15 Identities = 39/42 (92%), Positives = 41/42 (97%) Frame = -3 Query: 280 TTGKGKVNLAGTNVRSLEVFMCSIVRKMGYGDGFKWVSQYIN 155 TTGKGKVNLAGTNVR LEVFMCSIVRKMGYG+GFKWVSQYI+ Sbjct: 152 TTGKGKVNLAGTNVRPLEVFMCSIVRKMGYGEGFKWVSQYID 193 >ref|XP_002876677.1| Os01g0254000 [Arabidopsis lyrata subsp. lyrata] gi|297322515|gb|EFH52936.1| Os01g0254000 [Arabidopsis lyrata subsp. lyrata] Length = 193 Score = 85.1 bits (209), Expect = 9e-15 Identities = 39/42 (92%), Positives = 41/42 (97%) Frame = -3 Query: 280 TTGKGKVNLAGTNVRSLEVFMCSIVRKMGYGDGFKWVSQYIN 155 TTGKGKVNLAGTNVR LEVFMCSIVRKMGYG+GFKWVSQYI+ Sbjct: 152 TTGKGKVNLAGTNVRPLEVFMCSIVRKMGYGEGFKWVSQYID 193 >ref|NP_191815.1| Ras-related small GTP-binding family protein [Arabidopsis thaliana] gi|17979297|gb|AAL49874.1| putative Sar1 GTP binding protein [Arabidopsis thaliana] gi|21436475|gb|AAM51438.1| putative Sar1 GTP binding protein [Arabidopsis thaliana] gi|110736076|dbj|BAF00011.1| Sar1-like GTP binding protein [Arabidopsis thaliana] gi|332646843|gb|AEE80364.1| Ras-related small GTP-binding family protein [Arabidopsis thaliana] Length = 193 Score = 85.1 bits (209), Expect = 9e-15 Identities = 39/42 (92%), Positives = 41/42 (97%) Frame = -3 Query: 280 TTGKGKVNLAGTNVRSLEVFMCSIVRKMGYGDGFKWVSQYIN 155 TTGKGKVNLAGTNVR LEVFMCSIVRKMGYG+GFKWVSQYI+ Sbjct: 152 TTGKGKVNLAGTNVRPLEVFMCSIVRKMGYGEGFKWVSQYID 193 >ref|XP_004135993.1| PREDICTED: GTP-binding protein SAR1A-like [Cucumis sativus] gi|449505318|ref|XP_004162434.1| PREDICTED: GTP-binding protein SAR1A-like [Cucumis sativus] Length = 193 Score = 83.6 bits (205), Expect = 3e-14 Identities = 39/41 (95%), Positives = 39/41 (95%) Frame = -3 Query: 280 TTGKGKVNLAGTNVRSLEVFMCSIVRKMGYGDGFKWVSQYI 158 TTGKGKVNLA TNVR LEVFMCSIVRKMGYGDGFKWVSQYI Sbjct: 152 TTGKGKVNLADTNVRPLEVFMCSIVRKMGYGDGFKWVSQYI 192 >ref|XP_002489085.1| hypothetical protein SORBIDRAFT_0111s002010 [Sorghum bicolor] gi|241946992|gb|EES20137.1| hypothetical protein SORBIDRAFT_0111s002010 [Sorghum bicolor] Length = 193 Score = 82.0 bits (201), Expect = 7e-14 Identities = 37/42 (88%), Positives = 39/42 (92%) Frame = -3 Query: 280 TTGKGKVNLAGTNVRSLEVFMCSIVRKMGYGDGFKWVSQYIN 155 TTGKGKVNL +NVR LEVFMCS+VRKMGYGDGFKWVSQYIN Sbjct: 152 TTGKGKVNLGESNVRPLEVFMCSVVRKMGYGDGFKWVSQYIN 193 >gb|EMJ27092.1| hypothetical protein PRUPE_ppa011849mg [Prunus persica] Length = 193 Score = 81.6 bits (200), Expect = 1e-13 Identities = 37/42 (88%), Positives = 40/42 (95%) Frame = -3 Query: 280 TTGKGKVNLAGTNVRSLEVFMCSIVRKMGYGDGFKWVSQYIN 155 TTGKGKVNLA +NVR LEVFMCSIVRKMGYG+GFKW+SQYIN Sbjct: 152 TTGKGKVNLADSNVRPLEVFMCSIVRKMGYGEGFKWLSQYIN 193 >ref|XP_002512498.1| GTP-binding protein sar1, putative [Ricinus communis] gi|223548459|gb|EEF49950.1| GTP-binding protein sar1, putative [Ricinus communis] Length = 193 Score = 81.6 bits (200), Expect = 1e-13 Identities = 37/42 (88%), Positives = 39/42 (92%) Frame = -3 Query: 280 TTGKGKVNLAGTNVRSLEVFMCSIVRKMGYGDGFKWVSQYIN 155 TTGKGKVNL +NVR LEVFMCSIVRKMGYGDGFKW+SQYIN Sbjct: 152 TTGKGKVNLGDSNVRPLEVFMCSIVRKMGYGDGFKWLSQYIN 193 >gb|EXB66050.1| GTP-binding protein [Morus notabilis] Length = 149 Score = 80.9 bits (198), Expect = 2e-13 Identities = 37/41 (90%), Positives = 39/41 (95%) Frame = -3 Query: 280 TTGKGKVNLAGTNVRSLEVFMCSIVRKMGYGDGFKWVSQYI 158 TTGKGKVNLA +NVR LEVFMCSIVRKMGYGDGFKW+SQYI Sbjct: 108 TTGKGKVNLADSNVRPLEVFMCSIVRKMGYGDGFKWLSQYI 148 >gb|EXB47146.1| GTP-binding protein [Morus notabilis] Length = 189 Score = 80.9 bits (198), Expect = 2e-13 Identities = 37/41 (90%), Positives = 39/41 (95%) Frame = -3 Query: 280 TTGKGKVNLAGTNVRSLEVFMCSIVRKMGYGDGFKWVSQYI 158 TTGKGKVNLA +NVR LEVFMCSIVRKMGYGDGFKW+SQYI Sbjct: 148 TTGKGKVNLADSNVRPLEVFMCSIVRKMGYGDGFKWLSQYI 188 >gb|EXB47144.1| GTP-binding protein [Morus notabilis] gi|587876973|gb|EXB66047.1| GTP-binding protein [Morus notabilis] Length = 193 Score = 80.9 bits (198), Expect = 2e-13 Identities = 37/41 (90%), Positives = 39/41 (95%) Frame = -3 Query: 280 TTGKGKVNLAGTNVRSLEVFMCSIVRKMGYGDGFKWVSQYI 158 TTGKGKVNLA +NVR LEVFMCSIVRKMGYGDGFKW+SQYI Sbjct: 152 TTGKGKVNLADSNVRPLEVFMCSIVRKMGYGDGFKWLSQYI 192 >ref|XP_006444474.1| hypothetical protein CICLE_v10022379mg [Citrus clementina] gi|567903974|ref|XP_006444475.1| hypothetical protein CICLE_v10022379mg [Citrus clementina] gi|568878694|ref|XP_006492321.1| PREDICTED: GTP-binding protein SAR1A-like [Citrus sinensis] gi|557546736|gb|ESR57714.1| hypothetical protein CICLE_v10022379mg [Citrus clementina] gi|557546737|gb|ESR57715.1| hypothetical protein CICLE_v10022379mg [Citrus clementina] Length = 193 Score = 80.9 bits (198), Expect = 2e-13 Identities = 37/41 (90%), Positives = 39/41 (95%) Frame = -3 Query: 280 TTGKGKVNLAGTNVRSLEVFMCSIVRKMGYGDGFKWVSQYI 158 TTGKGKVNLA +NVR LEVFMCSIVRKMGYGDGFKW+SQYI Sbjct: 152 TTGKGKVNLADSNVRPLEVFMCSIVRKMGYGDGFKWLSQYI 192 >gb|EPS60431.1| hypothetical protein M569_14374 [Genlisea aurea] Length = 193 Score = 80.9 bits (198), Expect = 2e-13 Identities = 37/41 (90%), Positives = 39/41 (95%) Frame = -3 Query: 280 TTGKGKVNLAGTNVRSLEVFMCSIVRKMGYGDGFKWVSQYI 158 TTGKGKVNLA +NVR LEVFMCSIVRKMGYGDGFKW+SQYI Sbjct: 152 TTGKGKVNLADSNVRPLEVFMCSIVRKMGYGDGFKWMSQYI 192 >gb|EOX95241.1| Secretion-associated RAS super family 2 isoform 2 [Theobroma cacao] Length = 193 Score = 80.9 bits (198), Expect = 2e-13 Identities = 37/41 (90%), Positives = 39/41 (95%) Frame = -3 Query: 280 TTGKGKVNLAGTNVRSLEVFMCSIVRKMGYGDGFKWVSQYI 158 TTGKGKVNLA +NVR LEVFMCSIVRKMGYGDGFKW+SQYI Sbjct: 152 TTGKGKVNLADSNVRPLEVFMCSIVRKMGYGDGFKWMSQYI 192 >gb|EOX95240.1| Secretion-associated RAS super family 2 isoform 1 [Theobroma cacao] Length = 265 Score = 80.9 bits (198), Expect = 2e-13 Identities = 37/41 (90%), Positives = 39/41 (95%) Frame = -3 Query: 280 TTGKGKVNLAGTNVRSLEVFMCSIVRKMGYGDGFKWVSQYI 158 TTGKGKVNLA +NVR LEVFMCSIVRKMGYGDGFKW+SQYI Sbjct: 224 TTGKGKVNLADSNVRPLEVFMCSIVRKMGYGDGFKWMSQYI 264 >ref|XP_004300458.1| PREDICTED: GTP-binding protein SAR1A-like [Fragaria vesca subsp. vesca] Length = 193 Score = 80.9 bits (198), Expect = 2e-13 Identities = 37/41 (90%), Positives = 39/41 (95%) Frame = -3 Query: 280 TTGKGKVNLAGTNVRSLEVFMCSIVRKMGYGDGFKWVSQYI 158 TTGKGKVNLA +NVR LEVFMCSIVRKMGYGDGFKW+SQYI Sbjct: 152 TTGKGKVNLADSNVRPLEVFMCSIVRKMGYGDGFKWLSQYI 192 >ref|NP_001275076.1| GTP-binding protein SAR2-like [Solanum tuberosum] gi|78191446|gb|ABB29944.1| GTPase-like [Solanum tuberosum] Length = 193 Score = 80.9 bits (198), Expect = 2e-13 Identities = 36/41 (87%), Positives = 39/41 (95%) Frame = -3 Query: 280 TTGKGKVNLAGTNVRSLEVFMCSIVRKMGYGDGFKWVSQYI 158 TTGKG VNLAGTNVR +EVFMCSIVRKMGYG+GFKW+SQYI Sbjct: 152 TTGKGNVNLAGTNVRPIEVFMCSIVRKMGYGEGFKWMSQYI 192 >ref|XP_002275765.1| PREDICTED: GTP-binding protein SAR1A [Vitis vinifera] gi|297743967|emb|CBI36937.3| unnamed protein product [Vitis vinifera] Length = 193 Score = 80.9 bits (198), Expect = 2e-13 Identities = 37/41 (90%), Positives = 39/41 (95%) Frame = -3 Query: 280 TTGKGKVNLAGTNVRSLEVFMCSIVRKMGYGDGFKWVSQYI 158 TTGKGKVNLA +NVR LEVFMCSIVRKMGYGDGFKW+SQYI Sbjct: 152 TTGKGKVNLADSNVRPLEVFMCSIVRKMGYGDGFKWLSQYI 192 >ref|XP_002515297.1| GTP-binding protein sar1, putative [Ricinus communis] gi|223545777|gb|EEF47281.1| GTP-binding protein sar1, putative [Ricinus communis] Length = 193 Score = 80.9 bits (198), Expect = 2e-13 Identities = 37/41 (90%), Positives = 38/41 (92%) Frame = -3 Query: 280 TTGKGKVNLAGTNVRSLEVFMCSIVRKMGYGDGFKWVSQYI 158 TTGKGKVNL TNVR LEVFMCSIVRKMGYGDGFKW+SQYI Sbjct: 152 TTGKGKVNLTDTNVRPLEVFMCSIVRKMGYGDGFKWLSQYI 192 >ref|NP_001234640.1| GTP-binding protein SAR2 [Solanum lycopersicum] gi|1710851|sp|P52884.1|SAR2_SOLLC RecName: Full=GTP-binding protein SAR2 gi|473684|gb|AAA34168.1| GTPase [Solanum lycopersicum] Length = 193 Score = 80.5 bits (197), Expect = 2e-13 Identities = 35/41 (85%), Positives = 39/41 (95%) Frame = -3 Query: 280 TTGKGKVNLAGTNVRSLEVFMCSIVRKMGYGDGFKWVSQYI 158 TTGKG +NLAGTNVR +EVFMCSIVRKMGYG+GFKW+SQYI Sbjct: 152 TTGKGNINLAGTNVRPIEVFMCSIVRKMGYGEGFKWMSQYI 192