BLASTX nr result
ID: Achyranthes22_contig00017927
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes22_contig00017927 (318 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002306291.2| hypothetical protein POPTR_0005s07290g [Popu... 57 3e-06 ref|XP_006380403.1| hypothetical protein POPTR_0007s05010g [Popu... 57 3e-06 gb|ESW31703.1| hypothetical protein PHAVU_002G260700g [Phaseolus... 55 1e-05 gb|EOX92015.1| Alanine--glyoxylate aminotransferase 2 isoform 1 ... 55 1e-05 >ref|XP_002306291.2| hypothetical protein POPTR_0005s07290g [Populus trichocarpa] gi|550338317|gb|EEE93287.2| hypothetical protein POPTR_0005s07290g [Populus trichocarpa] Length = 329 Score = 57.0 bits (136), Expect = 3e-06 Identities = 27/36 (75%), Positives = 33/36 (91%), Gaps = 2/36 (5%) Frame = -2 Query: 104 MKRSLGSSDSLGALISMCPPSDEHSPRN--NIYSRE 3 MKRSLGSSDSLGAL+S+CP ++EHSPRN ++YSRE Sbjct: 1 MKRSLGSSDSLGALMSICPTTEEHSPRNSTHVYSRE 36 >ref|XP_006380403.1| hypothetical protein POPTR_0007s05010g [Populus trichocarpa] gi|118488246|gb|ABK95942.1| unknown [Populus trichocarpa] gi|550334160|gb|ERP58200.1| hypothetical protein POPTR_0007s05010g [Populus trichocarpa] Length = 328 Score = 57.0 bits (136), Expect = 3e-06 Identities = 27/36 (75%), Positives = 33/36 (91%), Gaps = 2/36 (5%) Frame = -2 Query: 104 MKRSLGSSDSLGALISMCPPSDEHSPRN--NIYSRE 3 MKRSLGSSDSLGAL+S+CP ++EHSPRN ++YSRE Sbjct: 1 MKRSLGSSDSLGALMSICPSAEEHSPRNHTHVYSRE 36 >gb|ESW31703.1| hypothetical protein PHAVU_002G260700g [Phaseolus vulgaris] Length = 303 Score = 55.1 bits (131), Expect = 1e-05 Identities = 27/35 (77%), Positives = 32/35 (91%), Gaps = 1/35 (2%) Frame = -2 Query: 104 MKRSLGSSDSLGALISMCPPSDEHSPRNN-IYSRE 3 MKR LGSSDSLGAL+++CPP+DEHSPRNN +Y RE Sbjct: 1 MKR-LGSSDSLGALMTICPPTDEHSPRNNHVYGRE 34 >gb|EOX92015.1| Alanine--glyoxylate aminotransferase 2 isoform 1 [Theobroma cacao] gi|508700120|gb|EOX92016.1| Pyrimidine 4 isoform 1 [Theobroma cacao] Length = 330 Score = 55.1 bits (131), Expect = 1e-05 Identities = 29/35 (82%), Positives = 32/35 (91%), Gaps = 1/35 (2%) Frame = -2 Query: 104 MKRSLGSSDSLGALISMCPPSDEHSPRNN-IYSRE 3 MKR LGSSDSLGAL+S+CP +DEHSPRNN IYSRE Sbjct: 1 MKR-LGSSDSLGALMSICPTTDEHSPRNNHIYSRE 34