BLASTX nr result
ID: Achyranthes22_contig00016227
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes22_contig00016227 (485 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AFS28707.1| putative farnesyl diphosphate synthase, partial [... 52 5e-11 gb|AFS28706.1| putative farnesyl diphosphate synthase, partial [... 52 6e-11 gb|EOY29020.1| Farnesyl diphosphate synthase 1 isoform 1 [Theobr... 52 1e-10 gb|EOY29021.1| Farnesyl diphosphate synthase 1 isoform 2, partia... 52 1e-10 dbj|BAB16687.2| putative FPP synthase 1 [Eucommia ulmoides] gi|4... 54 1e-10 gb|AAN62522.1| farnesyl pyrophosphate synthetase [Eucommia ulmoi... 54 1e-10 gb|AHG98061.1| farnesyl diphosphate synthase, partial [Plectrant... 51 1e-10 dbj|BAB60821.1| putative FPP synthase 1 [Eucommia ulmoides] 54 1e-10 gb|ABV08819.1| farnesyl diphosphate synthetase [Salvia miltiorrh... 50 2e-10 gb|AAK63847.1|AF384040_1 farnesyl diphosphate synthase [Mentha x... 50 2e-10 gb|AHH93009.1| farnesyl pyrophosphate synthase [Pyrus communis] 51 2e-10 gb|AAM08927.1| farnesyl pyrophosphate synthase [Malus domestica] 51 2e-10 gb|AAM98379.1| farnesyl diphosphate synthase [Hevea brasiliensis... 51 2e-10 gb|AEH30663.1| farnesyl diphosphate synthase [Malus domestica] 51 2e-10 gb|ADO95193.1| farnesyl diphosphate synthase [Catharanthus roseus] 50 2e-10 gb|ACN63187.1| farnesyl diphosphate synthase [Euphorbia pekinensis] 53 2e-10 gb|AEM42979.1| farnesyl diphosphate synthase [Siraitia grosvenorii] 50 3e-10 ref|NP_001267864.1| farnesyl diphosphate synthase [Vitis vinifer... 52 3e-10 gb|AHI44281.1| farnesyl pyrophosphate synthase [Gossypium hirsutum] 52 4e-10 dbj|BAF98301.1| farnesyl-diphosphate synthase [Hevea brasiliensis] 50 4e-10 >gb|AFS28707.1| putative farnesyl diphosphate synthase, partial [Olea europaea] Length = 291 Score = 52.0 bits (123), Expect(2) = 5e-11 Identities = 20/30 (66%), Positives = 27/30 (90%) Frame = +1 Query: 184 QIGSDIEESKCTWFIVKAFEICNEEQKKLL 273 +IG+DIE+ KC+W +VKA E+CNEEQKK+L Sbjct: 195 KIGTDIEDFKCSWLVVKALELCNEEQKKJL 224 Score = 40.8 bits (94), Expect(2) = 5e-11 Identities = 15/23 (65%), Positives = 20/23 (86%) Frame = +2 Query: 2 GIKVQEQNDYLDCFGDPDKVGKV 70 GI Q Q+DYLDCFGDP+++GK+ Sbjct: 174 GIYFQVQDDYLDCFGDPERIGKI 196 >gb|AFS28706.1| putative farnesyl diphosphate synthase, partial [Olea europaea] Length = 291 Score = 51.6 bits (122), Expect(2) = 6e-11 Identities = 20/30 (66%), Positives = 27/30 (90%) Frame = +1 Query: 184 QIGSDIEESKCTWFIVKAFEICNEEQKKLL 273 +IG+DIE+ KC+W +VKA E+CNEEQKK+L Sbjct: 195 KIGTDIEDFKCSWLVVKALELCNEEQKKIL 224 Score = 40.8 bits (94), Expect(2) = 6e-11 Identities = 15/23 (65%), Positives = 20/23 (86%) Frame = +2 Query: 2 GIKVQEQNDYLDCFGDPDKVGKV 70 GI Q Q+DYLDCFGDP+++GK+ Sbjct: 174 GIYFQVQDDYLDCFGDPERIGKI 196 >gb|EOY29020.1| Farnesyl diphosphate synthase 1 isoform 1 [Theobroma cacao] Length = 342 Score = 52.0 bits (123), Expect(2) = 1e-10 Identities = 21/30 (70%), Positives = 27/30 (90%) Frame = +1 Query: 184 QIGSDIEESKCTWFIVKAFEICNEEQKKLL 273 +IG+DIE+ KC+W +VKA EICNEEQKK+L Sbjct: 246 KIGTDIEDFKCSWLVVKALEICNEEQKKVL 275 Score = 39.7 bits (91), Expect(2) = 1e-10 Identities = 15/23 (65%), Positives = 19/23 (82%) Frame = +2 Query: 2 GIKVQEQNDYLDCFGDPDKVGKV 70 GI Q Q+DYLDCFGDP+ +GK+ Sbjct: 225 GIYFQVQDDYLDCFGDPETIGKI 247 >gb|EOY29021.1| Farnesyl diphosphate synthase 1 isoform 2, partial [Theobroma cacao] Length = 339 Score = 52.0 bits (123), Expect(2) = 1e-10 Identities = 21/30 (70%), Positives = 27/30 (90%) Frame = +1 Query: 184 QIGSDIEESKCTWFIVKAFEICNEEQKKLL 273 +IG+DIE+ KC+W +VKA EICNEEQKK+L Sbjct: 287 KIGTDIEDFKCSWLVVKALEICNEEQKKVL 316 Score = 39.7 bits (91), Expect(2) = 1e-10 Identities = 15/23 (65%), Positives = 19/23 (82%) Frame = +2 Query: 2 GIKVQEQNDYLDCFGDPDKVGKV 70 GI Q Q+DYLDCFGDP+ +GK+ Sbjct: 266 GIYFQVQDDYLDCFGDPETIGKI 288 >dbj|BAB16687.2| putative FPP synthase 1 [Eucommia ulmoides] gi|478621931|gb|AGJ03662.1| putative farnesyl diphosphate synthase 1 [Eucommia ulmoides] Length = 348 Score = 54.3 bits (129), Expect(2) = 1e-10 Identities = 22/30 (73%), Positives = 27/30 (90%) Frame = +1 Query: 184 QIGSDIEESKCTWFIVKAFEICNEEQKKLL 273 +IGSDIE+ KCTW +VKA E+CNEEQKK+L Sbjct: 252 KIGSDIEDFKCTWLVVKALELCNEEQKKIL 281 Score = 37.0 bits (84), Expect(2) = 1e-10 Identities = 14/23 (60%), Positives = 18/23 (78%) Frame = +2 Query: 2 GIKVQEQNDYLDCFGDPDKVGKV 70 G Q Q+DYLDCFGDP+ +GK+ Sbjct: 231 GSYFQVQDDYLDCFGDPEVIGKI 253 >gb|AAN62522.1| farnesyl pyrophosphate synthetase [Eucommia ulmoides] Length = 319 Score = 54.3 bits (129), Expect(2) = 1e-10 Identities = 22/30 (73%), Positives = 27/30 (90%) Frame = +1 Query: 184 QIGSDIEESKCTWFIVKAFEICNEEQKKLL 273 +IGSDIE+ KCTW +VKA E+CNEEQKK+L Sbjct: 252 KIGSDIEDFKCTWLVVKALELCNEEQKKIL 281 Score = 37.0 bits (84), Expect(2) = 1e-10 Identities = 14/23 (60%), Positives = 18/23 (78%) Frame = +2 Query: 2 GIKVQEQNDYLDCFGDPDKVGKV 70 G Q Q+DYLDCFGDP+ +GK+ Sbjct: 231 GSYFQVQDDYLDCFGDPEVIGKI 253 >gb|AHG98061.1| farnesyl diphosphate synthase, partial [Plectranthus barbatus] Length = 313 Score = 50.8 bits (120), Expect(2) = 1e-10 Identities = 21/34 (61%), Positives = 27/34 (79%) Frame = +1 Query: 184 QIGSDIEESKCTWFIVKAFEICNEEQKKLLCVIY 285 +IG+DIE+ KC+W +VKA E+CNEEQKK L Y Sbjct: 227 KIGTDIEDFKCSWLVVKALELCNEEQKKTLIEHY 260 Score = 40.4 bits (93), Expect(2) = 1e-10 Identities = 15/23 (65%), Positives = 20/23 (86%) Frame = +2 Query: 2 GIKVQEQNDYLDCFGDPDKVGKV 70 GI Q Q+DYLDCFG+P+K+GK+ Sbjct: 206 GIYFQVQDDYLDCFGEPEKIGKI 228 >dbj|BAB60821.1| putative FPP synthase 1 [Eucommia ulmoides] Length = 305 Score = 54.3 bits (129), Expect(2) = 1e-10 Identities = 22/30 (73%), Positives = 27/30 (90%) Frame = +1 Query: 184 QIGSDIEESKCTWFIVKAFEICNEEQKKLL 273 +IGSDIE+ KCTW +VKA E+CNEEQKK+L Sbjct: 209 KIGSDIEDFKCTWLVVKALELCNEEQKKIL 238 Score = 37.0 bits (84), Expect(2) = 1e-10 Identities = 13/22 (59%), Positives = 19/22 (86%) Frame = +2 Query: 5 IKVQEQNDYLDCFGDPDKVGKV 70 I ++ Q+DYLDCFGDP+ +GK+ Sbjct: 189 ILIEIQDDYLDCFGDPEVIGKI 210 >gb|ABV08819.1| farnesyl diphosphate synthetase [Salvia miltiorrhiza] gi|315019238|gb|ADT70780.1| farnesyl pyrophosphate synthase [Salvia miltiorrhiza] Length = 349 Score = 50.4 bits (119), Expect(2) = 2e-10 Identities = 20/30 (66%), Positives = 26/30 (86%) Frame = +1 Query: 184 QIGSDIEESKCTWFIVKAFEICNEEQKKLL 273 +IG+DIE+ KC+W +VKA E+CNEEQKK L Sbjct: 253 KIGTDIEDFKCSWLVVKALELCNEEQKKTL 282 Score = 40.4 bits (93), Expect(2) = 2e-10 Identities = 15/23 (65%), Positives = 20/23 (86%) Frame = +2 Query: 2 GIKVQEQNDYLDCFGDPDKVGKV 70 GI Q Q+DYLDCFG+P+K+GK+ Sbjct: 232 GIYFQVQDDYLDCFGEPEKIGKI 254 >gb|AAK63847.1|AF384040_1 farnesyl diphosphate synthase [Mentha x piperita] Length = 349 Score = 50.4 bits (119), Expect(2) = 2e-10 Identities = 20/30 (66%), Positives = 26/30 (86%) Frame = +1 Query: 184 QIGSDIEESKCTWFIVKAFEICNEEQKKLL 273 +IG+DIE+ KC+W +VKA E+CNEEQKK L Sbjct: 253 KIGTDIEDFKCSWLVVKALELCNEEQKKTL 282 Score = 40.4 bits (93), Expect(2) = 2e-10 Identities = 15/23 (65%), Positives = 20/23 (86%) Frame = +2 Query: 2 GIKVQEQNDYLDCFGDPDKVGKV 70 GI Q Q+DYLDCFG+P+K+GK+ Sbjct: 232 GIYFQVQDDYLDCFGEPEKIGKI 254 >gb|AHH93009.1| farnesyl pyrophosphate synthase [Pyrus communis] Length = 342 Score = 51.2 bits (121), Expect(2) = 2e-10 Identities = 20/30 (66%), Positives = 27/30 (90%) Frame = +1 Query: 184 QIGSDIEESKCTWFIVKAFEICNEEQKKLL 273 +IG+DIE+ KC+W +VKA E+CNEEQKK+L Sbjct: 246 KIGTDIEDFKCSWLVVKALELCNEEQKKVL 275 Score = 39.7 bits (91), Expect(2) = 2e-10 Identities = 15/23 (65%), Positives = 19/23 (82%) Frame = +2 Query: 2 GIKVQEQNDYLDCFGDPDKVGKV 70 GI Q Q+DYLDCFGDP+ +GK+ Sbjct: 225 GIYFQVQDDYLDCFGDPETIGKI 247 >gb|AAM08927.1| farnesyl pyrophosphate synthase [Malus domestica] Length = 342 Score = 51.2 bits (121), Expect(2) = 2e-10 Identities = 20/30 (66%), Positives = 27/30 (90%) Frame = +1 Query: 184 QIGSDIEESKCTWFIVKAFEICNEEQKKLL 273 +IG+DIE+ KC+W +VKA E+CNEEQKK+L Sbjct: 246 KIGTDIEDFKCSWLVVKALELCNEEQKKVL 275 Score = 39.7 bits (91), Expect(2) = 2e-10 Identities = 15/23 (65%), Positives = 19/23 (82%) Frame = +2 Query: 2 GIKVQEQNDYLDCFGDPDKVGKV 70 GI Q Q+DYLDCFGDP+ +GK+ Sbjct: 225 GIYFQVQDDYLDCFGDPETIGKI 247 >gb|AAM98379.1| farnesyl diphosphate synthase [Hevea brasiliensis] gi|34013692|gb|AAQ56011.1| farnesyl diphosphate synthase [Hevea brasiliensis] Length = 342 Score = 51.2 bits (121), Expect(2) = 2e-10 Identities = 20/30 (66%), Positives = 27/30 (90%) Frame = +1 Query: 184 QIGSDIEESKCTWFIVKAFEICNEEQKKLL 273 +IG+DIE+ KC+W +VKA E+CNEEQKK+L Sbjct: 246 KIGTDIEDFKCSWLVVKALELCNEEQKKVL 275 Score = 39.7 bits (91), Expect(2) = 2e-10 Identities = 15/23 (65%), Positives = 19/23 (82%) Frame = +2 Query: 2 GIKVQEQNDYLDCFGDPDKVGKV 70 GI Q Q+DYLDCFGDP+ +GK+ Sbjct: 225 GIYFQVQDDYLDCFGDPETIGKI 247 >gb|AEH30663.1| farnesyl diphosphate synthase [Malus domestica] Length = 304 Score = 51.2 bits (121), Expect(2) = 2e-10 Identities = 20/30 (66%), Positives = 27/30 (90%) Frame = +1 Query: 184 QIGSDIEESKCTWFIVKAFEICNEEQKKLL 273 +IG+DIE+ KC+W +VKA E+CNEEQKK+L Sbjct: 246 KIGTDIEDFKCSWLVVKALELCNEEQKKVL 275 Score = 39.7 bits (91), Expect(2) = 2e-10 Identities = 15/23 (65%), Positives = 19/23 (82%) Frame = +2 Query: 2 GIKVQEQNDYLDCFGDPDKVGKV 70 GI Q Q+DYLDCFGDP+ +GK+ Sbjct: 225 GIYFQVQDDYLDCFGDPETIGKI 247 >gb|ADO95193.1| farnesyl diphosphate synthase [Catharanthus roseus] Length = 345 Score = 50.1 bits (118), Expect(2) = 2e-10 Identities = 21/34 (61%), Positives = 27/34 (79%) Frame = +1 Query: 184 QIGSDIEESKCTWFIVKAFEICNEEQKKLLCVIY 285 +IG+DIE+ KC+W +VKA E CNEEQKK+L Y Sbjct: 249 KIGTDIEDFKCSWLVVKALERCNEEQKKILLEHY 282 Score = 40.4 bits (93), Expect(2) = 2e-10 Identities = 15/23 (65%), Positives = 20/23 (86%) Frame = +2 Query: 2 GIKVQEQNDYLDCFGDPDKVGKV 70 GI Q Q+DYLDCFG+P+K+GK+ Sbjct: 228 GIYFQVQDDYLDCFGEPEKIGKI 250 >gb|ACN63187.1| farnesyl diphosphate synthase [Euphorbia pekinensis] Length = 342 Score = 53.1 bits (126), Expect(2) = 2e-10 Identities = 21/34 (61%), Positives = 29/34 (85%) Frame = +1 Query: 184 QIGSDIEESKCTWFIVKAFEICNEEQKKLLCVIY 285 +IG+DIE+ KC+W +VKA E+CNEEQKK+L +Y Sbjct: 246 KIGTDIEDFKCSWMVVKALEVCNEEQKKVLHELY 279 Score = 37.4 bits (85), Expect(2) = 2e-10 Identities = 14/23 (60%), Positives = 18/23 (78%) Frame = +2 Query: 2 GIKVQEQNDYLDCFGDPDKVGKV 70 GI Q Q+DYLDC+GDP +GK+ Sbjct: 225 GIYFQVQDDYLDCYGDPKTIGKI 247 >gb|AEM42979.1| farnesyl diphosphate synthase [Siraitia grosvenorii] Length = 342 Score = 50.4 bits (119), Expect(2) = 3e-10 Identities = 20/34 (58%), Positives = 27/34 (79%) Frame = +1 Query: 184 QIGSDIEESKCTWFIVKAFEICNEEQKKLLCVIY 285 ++G+DIE+ KC+W +VKA E+CNEEQ KLL Y Sbjct: 246 KVGTDIEDFKCSWLVVKALELCNEEQNKLLHEAY 279 Score = 39.7 bits (91), Expect(2) = 3e-10 Identities = 15/23 (65%), Positives = 19/23 (82%) Frame = +2 Query: 2 GIKVQEQNDYLDCFGDPDKVGKV 70 G+ Q Q+DYLDCFGDP+ +GKV Sbjct: 225 GVYFQVQDDYLDCFGDPETIGKV 247 >ref|NP_001267864.1| farnesyl diphosphate synthase [Vitis vinifera] gi|62199628|gb|AAX76910.1| farnesyl diphosphate synthase [Vitis vinifera] Length = 341 Score = 51.6 bits (122), Expect(2) = 3e-10 Identities = 22/30 (73%), Positives = 26/30 (86%) Frame = +1 Query: 184 QIGSDIEESKCTWFIVKAFEICNEEQKKLL 273 +IG+DIE+ KC+W IVKA EICNEEQKK L Sbjct: 245 KIGTDIEDFKCSWLIVKALEICNEEQKKTL 274 Score = 38.5 bits (88), Expect(2) = 3e-10 Identities = 15/23 (65%), Positives = 18/23 (78%) Frame = +2 Query: 2 GIKVQEQNDYLDCFGDPDKVGKV 70 GI Q Q+DYLDCFGDP +GK+ Sbjct: 224 GIYFQVQDDYLDCFGDPQVIGKI 246 >gb|AHI44281.1| farnesyl pyrophosphate synthase [Gossypium hirsutum] Length = 342 Score = 52.0 bits (123), Expect(2) = 4e-10 Identities = 21/30 (70%), Positives = 27/30 (90%) Frame = +1 Query: 184 QIGSDIEESKCTWFIVKAFEICNEEQKKLL 273 +IG+DIE+ KC+W +VKA EICNEEQKK+L Sbjct: 246 KIGTDIEDFKCSWLVVKALEICNEEQKKVL 275 Score = 37.7 bits (86), Expect(2) = 4e-10 Identities = 14/23 (60%), Positives = 19/23 (82%) Frame = +2 Query: 2 GIKVQEQNDYLDCFGDPDKVGKV 70 GI Q Q+DYLDCFG+P+ +GK+ Sbjct: 225 GIYFQVQDDYLDCFGNPETIGKI 247 >dbj|BAF98301.1| farnesyl-diphosphate synthase [Hevea brasiliensis] Length = 342 Score = 50.1 bits (118), Expect(2) = 4e-10 Identities = 19/30 (63%), Positives = 27/30 (90%) Frame = +1 Query: 184 QIGSDIEESKCTWFIVKAFEICNEEQKKLL 273 +IG+DIE+ KC+W +VKA E+CNEEQ+K+L Sbjct: 246 KIGTDIEDFKCSWLVVKALELCNEEQRKVL 275 Score = 39.7 bits (91), Expect(2) = 4e-10 Identities = 15/23 (65%), Positives = 19/23 (82%) Frame = +2 Query: 2 GIKVQEQNDYLDCFGDPDKVGKV 70 GI Q Q+DYLDCFGDP+ +GK+ Sbjct: 225 GIYFQVQDDYLDCFGDPETIGKI 247