BLASTX nr result
ID: Achyranthes22_contig00016194
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes22_contig00016194 (283 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAF32411.1|AF230278_1 alpha-expansin 1 [Triphysaria versicolor] 56 4e-06 gb|AAM22627.1|AF428180_1 expansin 13 precursor [Rumex palustris] 56 4e-06 gb|AAM22628.1|AF428181_1 expansin 14 precursor [Rumex palustris] 55 1e-05 >gb|AAF32411.1|AF230278_1 alpha-expansin 1 [Triphysaria versicolor] Length = 249 Score = 56.2 bits (134), Expect = 4e-06 Identities = 28/42 (66%), Positives = 30/42 (71%) Frame = +3 Query: 156 MEAINVFLVGILAFFSIAEAYGRGSGGWTSAHATFYGGGDAS 281 M AI +FLVG LA S E G G GGW +AHATFYGGGDAS Sbjct: 1 MAAIGLFLVGFLAIISNVE--GNGVGGWVNAHATFYGGGDAS 40 >gb|AAM22627.1|AF428180_1 expansin 13 precursor [Rumex palustris] Length = 250 Score = 56.2 bits (134), Expect = 4e-06 Identities = 26/42 (61%), Positives = 31/42 (73%) Frame = +3 Query: 156 MEAINVFLVGILAFFSIAEAYGRGSGGWTSAHATFYGGGDAS 281 M + + LVG+LA + AE Y RG GGW +AHATFYGGGDAS Sbjct: 1 MAVVGLLLVGLLAMAASAEGY-RGGGGWVNAHATFYGGGDAS 41 >gb|AAM22628.1|AF428181_1 expansin 14 precursor [Rumex palustris] Length = 250 Score = 55.1 bits (131), Expect = 1e-05 Identities = 25/42 (59%), Positives = 31/42 (73%) Frame = +3 Query: 156 MEAINVFLVGILAFFSIAEAYGRGSGGWTSAHATFYGGGDAS 281 M + + L+G+LA + AE Y RG GGW +AHATFYGGGDAS Sbjct: 1 MAVVGLLLLGLLAMAASAEGY-RGGGGWVNAHATFYGGGDAS 41