BLASTX nr result
ID: Achyranthes22_contig00016159
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes22_contig00016159 (352 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006372218.1| hypothetical protein POPTR_0018s14360g [Popu... 77 2e-12 ref|XP_002331436.1| predicted protein [Populus trichocarpa] gi|5... 77 2e-12 ref|XP_002511816.1| pentatricopeptide repeat-containing protein,... 77 3e-12 ref|XP_006453186.1| hypothetical protein CICLE_v10010414mg [Citr... 75 7e-12 gb|EMJ23653.1| hypothetical protein PRUPE_ppa006191mg [Prunus pe... 75 7e-12 ref|XP_004152890.1| PREDICTED: pentatricopeptide repeat-containi... 75 9e-12 ref|XP_002265876.1| PREDICTED: pentatricopeptide repeat-containi... 74 3e-11 emb|CAN79718.1| hypothetical protein VITISV_012741 [Vitis vinifera] 74 3e-11 ref|XP_004301396.1| PREDICTED: pentatricopeptide repeat-containi... 72 8e-11 ref|XP_006418860.1| hypothetical protein EUTSA_v10003041mg [Eutr... 69 5e-10 ref|XP_006850970.1| hypothetical protein AMTR_s00025p00206120 [A... 69 7e-10 gb|EOY32179.1| Pentatricopeptide repeat superfamily protein, put... 68 1e-09 gb|ABA18111.1| pentatricopeptide repeat protein [Arabidopsis are... 68 1e-09 gb|ESW06704.1| hypothetical protein PHAVU_010G069800g [Phaseolus... 68 1e-09 gb|ESW06703.1| hypothetical protein PHAVU_010G069800g [Phaseolus... 68 1e-09 gb|ESW04320.1| hypothetical protein PHAVU_011G085400g [Phaseolus... 68 1e-09 gb|ABA18097.1| pentatricopeptide repeat protein [Olimarabidopsis... 68 1e-09 ref|NP_566863.2| pentatricopeptide repeat-containing protein [Ar... 68 1e-09 ref|XP_002875580.1| pentatricopeptide repeat protein [Arabidopsi... 68 1e-09 emb|CAB86446.1| putative protein [Arabidopsis thaliana] 68 1e-09 >ref|XP_006372218.1| hypothetical protein POPTR_0018s14360g [Populus trichocarpa] gi|550318749|gb|ERP50015.1| hypothetical protein POPTR_0018s14360g [Populus trichocarpa] Length = 392 Score = 77.0 bits (188), Expect = 2e-12 Identities = 31/44 (70%), Positives = 39/44 (88%) Frame = -1 Query: 349 GKGDFHSNSESFMEFSEDRRWTYRKLIEIHLKKRHRSNQIFWNY 218 GKGDFHS+SE+FMEF R+WTYR+LI+I+L+K+HRS IFWNY Sbjct: 349 GKGDFHSSSEAFMEFKRQRKWTYRELIKIYLRKQHRSKHIFWNY 392 >ref|XP_002331436.1| predicted protein [Populus trichocarpa] gi|566215849|ref|XP_006372219.1| pentatricopeptide repeat-containing family protein [Populus trichocarpa] gi|550318750|gb|ERP50016.1| pentatricopeptide repeat-containing family protein [Populus trichocarpa] Length = 428 Score = 77.0 bits (188), Expect = 2e-12 Identities = 31/44 (70%), Positives = 39/44 (88%) Frame = -1 Query: 349 GKGDFHSNSESFMEFSEDRRWTYRKLIEIHLKKRHRSNQIFWNY 218 GKGDFHS+SE+FMEF R+WTYR+LI+I+L+K+HRS IFWNY Sbjct: 385 GKGDFHSSSEAFMEFKRQRKWTYRELIKIYLRKQHRSKHIFWNY 428 >ref|XP_002511816.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223548996|gb|EEF50485.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 427 Score = 76.6 bits (187), Expect = 3e-12 Identities = 29/45 (64%), Positives = 41/45 (91%) Frame = -1 Query: 352 MGKGDFHSNSESFMEFSEDRRWTYRKLIEIHLKKRHRSNQIFWNY 218 +GKGDFHS++E+F+EF R+WTYR+L+ I+L+K++RSNQIFWNY Sbjct: 383 LGKGDFHSSAEAFLEFKRQRKWTYRELVSIYLRKQYRSNQIFWNY 427 >ref|XP_006453186.1| hypothetical protein CICLE_v10010414mg [Citrus clementina] gi|568840749|ref|XP_006474328.1| PREDICTED: pentatricopeptide repeat-containing protein At3g42630-like isoform X1 [Citrus sinensis] gi|568840751|ref|XP_006474329.1| PREDICTED: pentatricopeptide repeat-containing protein At3g42630-like isoform X2 [Citrus sinensis] gi|568840753|ref|XP_006474330.1| PREDICTED: pentatricopeptide repeat-containing protein At3g42630-like isoform X3 [Citrus sinensis] gi|568840755|ref|XP_006474331.1| PREDICTED: pentatricopeptide repeat-containing protein At3g42630-like isoform X4 [Citrus sinensis] gi|568840757|ref|XP_006474332.1| PREDICTED: pentatricopeptide repeat-containing protein At3g42630-like isoform X5 [Citrus sinensis] gi|568840759|ref|XP_006474333.1| PREDICTED: pentatricopeptide repeat-containing protein At3g42630-like isoform X6 [Citrus sinensis] gi|557556412|gb|ESR66426.1| hypothetical protein CICLE_v10010414mg [Citrus clementina] Length = 412 Score = 75.5 bits (184), Expect = 7e-12 Identities = 31/44 (70%), Positives = 38/44 (86%) Frame = -1 Query: 349 GKGDFHSNSESFMEFSEDRRWTYRKLIEIHLKKRHRSNQIFWNY 218 GKGDFHS+SE+F+EF R+WTYRKLI ++LKK+ R NQIFWNY Sbjct: 369 GKGDFHSSSEAFLEFKRQRKWTYRKLIAVYLKKQLRRNQIFWNY 412 >gb|EMJ23653.1| hypothetical protein PRUPE_ppa006191mg [Prunus persica] Length = 423 Score = 75.5 bits (184), Expect = 7e-12 Identities = 29/45 (64%), Positives = 39/45 (86%) Frame = -1 Query: 352 MGKGDFHSNSESFMEFSEDRRWTYRKLIEIHLKKRHRSNQIFWNY 218 +GKGDFH++SE+F+EF R WTYR+LI ++LKK++R NQIFWNY Sbjct: 379 LGKGDFHASSEAFLEFQSQREWTYRRLISVYLKKQYRRNQIFWNY 423 >ref|XP_004152890.1| PREDICTED: pentatricopeptide repeat-containing protein At3g42630-like [Cucumis sativus] gi|449507537|ref|XP_004163059.1| PREDICTED: pentatricopeptide repeat-containing protein At3g42630-like [Cucumis sativus] Length = 388 Score = 75.1 bits (183), Expect = 9e-12 Identities = 28/45 (62%), Positives = 39/45 (86%) Frame = -1 Query: 352 MGKGDFHSNSESFMEFSEDRRWTYRKLIEIHLKKRHRSNQIFWNY 218 +GKGDFH +SE+FM+F + ++WTYR+LI ++LKK HR NQ+FWNY Sbjct: 344 LGKGDFHMSSEAFMQFRKQKKWTYRELISLYLKKHHRRNQVFWNY 388 >ref|XP_002265876.1| PREDICTED: pentatricopeptide repeat-containing protein At3g42630 [Vitis vinifera] gi|297736023|emb|CBI24061.3| unnamed protein product [Vitis vinifera] Length = 423 Score = 73.6 bits (179), Expect = 3e-11 Identities = 30/45 (66%), Positives = 39/45 (86%) Frame = -1 Query: 352 MGKGDFHSNSESFMEFSEDRRWTYRKLIEIHLKKRHRSNQIFWNY 218 +GKGDFHS+SE+F+E + +WTYRKLI +LKK++RSNQIFWNY Sbjct: 379 LGKGDFHSSSEAFLESKRNGKWTYRKLIATYLKKKYRSNQIFWNY 423 >emb|CAN79718.1| hypothetical protein VITISV_012741 [Vitis vinifera] Length = 446 Score = 73.6 bits (179), Expect = 3e-11 Identities = 30/45 (66%), Positives = 39/45 (86%) Frame = -1 Query: 352 MGKGDFHSNSESFMEFSEDRRWTYRKLIEIHLKKRHRSNQIFWNY 218 +GKGDFHS+SE+F+E + +WTYRKLI +LKK++RSNQIFWNY Sbjct: 402 LGKGDFHSSSEAFLESKRNGKWTYRKLIATYLKKKYRSNQIFWNY 446 >ref|XP_004301396.1| PREDICTED: pentatricopeptide repeat-containing protein At3g42630-like [Fragaria vesca subsp. vesca] Length = 424 Score = 72.0 bits (175), Expect = 8e-11 Identities = 27/45 (60%), Positives = 40/45 (88%) Frame = -1 Query: 352 MGKGDFHSNSESFMEFSEDRRWTYRKLIEIHLKKRHRSNQIFWNY 218 +GKGDFH++SE+F+EF + + WTY+KLI ++LKK++R +QIFWNY Sbjct: 380 LGKGDFHASSEAFLEFRKQKEWTYQKLISVYLKKQYRRDQIFWNY 424 >ref|XP_006418860.1| hypothetical protein EUTSA_v10003041mg [Eutrema salsugineum] gi|557096788|gb|ESQ37296.1| hypothetical protein EUTSA_v10003041mg [Eutrema salsugineum] Length = 424 Score = 69.3 bits (168), Expect = 5e-10 Identities = 28/45 (62%), Positives = 37/45 (82%) Frame = -1 Query: 352 MGKGDFHSNSESFMEFSEDRRWTYRKLIEIHLKKRHRSNQIFWNY 218 MGKGDFH +SE+ +EF + + WTYRKLI ++LKK+ R +QIFWNY Sbjct: 380 MGKGDFHLSSEAVLEFGQRKNWTYRKLIGVYLKKKFRRDQIFWNY 424 >ref|XP_006850970.1| hypothetical protein AMTR_s00025p00206120 [Amborella trichopoda] gi|548854641|gb|ERN12551.1| hypothetical protein AMTR_s00025p00206120 [Amborella trichopoda] Length = 354 Score = 68.9 bits (167), Expect = 7e-10 Identities = 28/44 (63%), Positives = 35/44 (79%) Frame = -1 Query: 349 GKGDFHSNSESFMEFSEDRRWTYRKLIEIHLKKRHRSNQIFWNY 218 GKGDFHS+SE+ +E + WTY KL+ +LKKR+RSNQIFWNY Sbjct: 311 GKGDFHSSSEALLELKWKKEWTYSKLVAFYLKKRYRSNQIFWNY 354 >gb|EOY32179.1| Pentatricopeptide repeat superfamily protein, putative [Theobroma cacao] Length = 429 Score = 68.2 bits (165), Expect = 1e-09 Identities = 28/46 (60%), Positives = 40/46 (86%), Gaps = 1/46 (2%) Frame = -1 Query: 352 MGKGDFHSNSESFMEFS-EDRRWTYRKLIEIHLKKRHRSNQIFWNY 218 +GKGDFHS++E+F+EF + ++WTYR+LI ++LKK+ R NQIFWNY Sbjct: 384 LGKGDFHSSAEAFLEFKRQKKKWTYRQLIAVYLKKQLRRNQIFWNY 429 >gb|ABA18111.1| pentatricopeptide repeat protein [Arabidopsis arenosa] Length = 419 Score = 68.2 bits (165), Expect = 1e-09 Identities = 27/45 (60%), Positives = 38/45 (84%) Frame = -1 Query: 352 MGKGDFHSNSESFMEFSEDRRWTYRKLIEIHLKKRHRSNQIFWNY 218 +GKGDFH +SE+ +EFS ++ WTYRKLI +++KK+ R +QIFWNY Sbjct: 375 LGKGDFHLSSEAVLEFSTEKNWTYRKLIGVYVKKKLRRDQIFWNY 419 >gb|ESW06704.1| hypothetical protein PHAVU_010G069800g [Phaseolus vulgaris] gi|561007757|gb|ESW06706.1| hypothetical protein PHAVU_010G069800g [Phaseolus vulgaris] Length = 423 Score = 67.8 bits (164), Expect = 1e-09 Identities = 28/45 (62%), Positives = 35/45 (77%) Frame = -1 Query: 352 MGKGDFHSNSESFMEFSEDRRWTYRKLIEIHLKKRHRSNQIFWNY 218 +GKGDF +SE+F EF R+WTYR LI+ +LKK +R NQIFWNY Sbjct: 379 LGKGDFQMSSEAFFEFKTHRKWTYRALIQKYLKKHYRRNQIFWNY 423 >gb|ESW06703.1| hypothetical protein PHAVU_010G069800g [Phaseolus vulgaris] gi|561007756|gb|ESW06705.1| hypothetical protein PHAVU_010G069800g [Phaseolus vulgaris] Length = 372 Score = 67.8 bits (164), Expect = 1e-09 Identities = 28/45 (62%), Positives = 35/45 (77%) Frame = -1 Query: 352 MGKGDFHSNSESFMEFSEDRRWTYRKLIEIHLKKRHRSNQIFWNY 218 +GKGDF +SE+F EF R+WTYR LI+ +LKK +R NQIFWNY Sbjct: 328 LGKGDFQMSSEAFFEFKTHRKWTYRALIQKYLKKHYRRNQIFWNY 372 >gb|ESW04320.1| hypothetical protein PHAVU_011G085400g [Phaseolus vulgaris] gi|561005327|gb|ESW04321.1| hypothetical protein PHAVU_011G085400g [Phaseolus vulgaris] Length = 411 Score = 67.8 bits (164), Expect = 1e-09 Identities = 28/45 (62%), Positives = 35/45 (77%) Frame = -1 Query: 352 MGKGDFHSNSESFMEFSEDRRWTYRKLIEIHLKKRHRSNQIFWNY 218 +GKGDF +SE+F EF R+WTYR LI+ +LKK +R NQIFWNY Sbjct: 367 LGKGDFQMSSEAFFEFKTHRKWTYRALIQKYLKKHYRRNQIFWNY 411 >gb|ABA18097.1| pentatricopeptide repeat protein [Olimarabidopsis pumila] Length = 424 Score = 67.8 bits (164), Expect = 1e-09 Identities = 28/45 (62%), Positives = 37/45 (82%) Frame = -1 Query: 352 MGKGDFHSNSESFMEFSEDRRWTYRKLIEIHLKKRHRSNQIFWNY 218 +GKGDFH +SE+ +EFS +WTYRKLI ++LKK+ R +QIFWNY Sbjct: 380 LGKGDFHLSSEAVLEFSPREKWTYRKLIGVYLKKKLRRDQIFWNY 424 >ref|NP_566863.2| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|218546757|sp|Q9M2A1.2|PP263_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At3g42630 gi|332644221|gb|AEE77742.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] Length = 415 Score = 67.8 bits (164), Expect = 1e-09 Identities = 28/45 (62%), Positives = 37/45 (82%) Frame = -1 Query: 352 MGKGDFHSNSESFMEFSEDRRWTYRKLIEIHLKKRHRSNQIFWNY 218 +GKGDFH +SE+ +EFS + WTYRKLI ++LKK+ R +QIFWNY Sbjct: 371 LGKGDFHLSSEAVLEFSPRKNWTYRKLIGVYLKKKLRRDQIFWNY 415 >ref|XP_002875580.1| pentatricopeptide repeat protein [Arabidopsis lyrata subsp. lyrata] gi|297321418|gb|EFH51839.1| pentatricopeptide repeat protein [Arabidopsis lyrata subsp. lyrata] Length = 419 Score = 67.8 bits (164), Expect = 1e-09 Identities = 28/45 (62%), Positives = 37/45 (82%) Frame = -1 Query: 352 MGKGDFHSNSESFMEFSEDRRWTYRKLIEIHLKKRHRSNQIFWNY 218 +GKGDFH +SE+ +EFS + WTYRKLI ++LKK+ R +QIFWNY Sbjct: 375 LGKGDFHLSSEAVLEFSPRKNWTYRKLIGVYLKKKLRRDQIFWNY 419 >emb|CAB86446.1| putative protein [Arabidopsis thaliana] Length = 412 Score = 67.8 bits (164), Expect = 1e-09 Identities = 28/45 (62%), Positives = 37/45 (82%) Frame = -1 Query: 352 MGKGDFHSNSESFMEFSEDRRWTYRKLIEIHLKKRHRSNQIFWNY 218 +GKGDFH +SE+ +EFS + WTYRKLI ++LKK+ R +QIFWNY Sbjct: 368 LGKGDFHLSSEAVLEFSPRKNWTYRKLIGVYLKKKLRRDQIFWNY 412