BLASTX nr result
ID: Achyranthes22_contig00015561
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes22_contig00015561 (595 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004298312.1| PREDICTED: uncharacterized protein LOC101290... 57 4e-06 >ref|XP_004298312.1| PREDICTED: uncharacterized protein LOC101290951 [Fragaria vesca subsp. vesca] Length = 544 Score = 57.0 bits (136), Expect = 4e-06 Identities = 35/104 (33%), Positives = 54/104 (51%), Gaps = 7/104 (6%) Frame = +1 Query: 295 PFLSPHLHRRRQRHPFLTL-----RNTTFRCPSAIADNK--TSWVLPDDAPPLHFNGWDL 453 P + L RRR P +TL + R ++ +D SW PD P H+ GW Sbjct: 11 PTYTSFLVRRRSISPTVTLHKPRSQRLPHRLSASFSDQSFDLSWFPPD---PDHYGGWG- 66 Query: 454 PHPSQLPNKNQGFPTFLVAGIGTSIALLLAAFTHFTFSKNGFRF 585 P P+ + KN G TF++ IG S+A+ +AA +F+ ++ GF+F Sbjct: 67 PLPAPIHPKNHGLHTFVIRTIGASVAVAVAAIAYFSLTRKGFKF 110