BLASTX nr result
ID: Achyranthes22_contig00014839
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes22_contig00014839 (288 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006293858.1| hypothetical protein CARUB_v10022842mg [Caps... 79 5e-13 ref|XP_004135902.1| PREDICTED: citrate synthase, mitochondrial-l... 79 5e-13 ref|XP_006482805.1| PREDICTED: citrate synthase, mitochondrial i... 79 6e-13 ref|XP_006439016.1| hypothetical protein CICLE_v10031423mg [Citr... 79 6e-13 ref|NP_001275779.1| citrate synthase [Citrus sinensis] gi|255928... 79 6e-13 gb|AAR88248.1| mitochondrial citrate synthase precursor [Citrus ... 79 6e-13 emb|CAA59008.1| citrate synthase [Nicotiana tabacum] 79 8e-13 ref|XP_006397611.1| hypothetical protein EUTSA_v10001384mg [Eutr... 78 1e-12 ref|NP_566016.1| citrate synthase 4 [Arabidopsis thaliana] gi|14... 78 1e-12 gb|AAM62868.1| citrate synthase [Arabidopsis thaliana] 78 1e-12 gb|ADZ05826.1| citrate synthase [Citrus maxima] 78 1e-12 gb|AFL48183.1| citrate synthase [Capsicum annuum] 77 2e-12 ref|XP_006836545.1| hypothetical protein AMTR_s00131p00035560 [A... 77 3e-12 ref|XP_006359150.1| PREDICTED: citrate synthase, mitochondrial-l... 76 4e-12 ref|XP_004229342.1| PREDICTED: citrate synthase, mitochondrial-l... 76 4e-12 gb|EMJ19154.1| hypothetical protein PRUPE_ppa005193mg [Prunus pe... 74 2e-11 gb|AAL11504.1|AF367444_1 citrate synthase [Prunus persica] 74 2e-11 ref|NP_850415.1| citrate synthase 4 [Arabidopsis thaliana] gi|41... 74 3e-11 ref|XP_002880107.1| hypothetical protein ARALYDRAFT_483560 [Arab... 74 3e-11 sp|P49298.1|CISY_CITMA RecName: Full=Citrate synthase, mitochond... 73 3e-11 >ref|XP_006293858.1| hypothetical protein CARUB_v10022842mg [Capsella rubella] gi|482562566|gb|EOA26756.1| hypothetical protein CARUB_v10022842mg [Capsella rubella] Length = 606 Score = 79.3 bits (194), Expect = 5e-13 Identities = 39/57 (68%), Positives = 50/57 (87%), Gaps = 2/57 (3%) Frame = -2 Query: 167 IMSFFRGLSSLAKLRSRAGQQSDLTNSVRWIQMQSSS--DLRSELQELIPQQQERLK 3 IM FFR +S+ ++LRSR GQQS L+NSVRW+QMQSS+ DL+S+LQELIP+QQ+RLK Sbjct: 133 IMVFFRSVSAFSRLRSRVGQQSSLSNSVRWLQMQSSTDMDLKSQLQELIPEQQDRLK 189 >ref|XP_004135902.1| PREDICTED: citrate synthase, mitochondrial-like [Cucumis sativus] gi|449524948|ref|XP_004169483.1| PREDICTED: citrate synthase, mitochondrial-like [Cucumis sativus] Length = 471 Score = 79.3 bits (194), Expect = 5e-13 Identities = 39/56 (69%), Positives = 51/56 (91%), Gaps = 2/56 (3%) Frame = -2 Query: 164 MSFFRGLSSLAKLRSRAGQQSDLTNSVRWIQMQSSS--DLRSELQELIPQQQERLK 3 M+FF+ L++L+KLRSR GQQS+L+NSVRW+QMQSSS DL+S L+ELIP+QQ+RLK Sbjct: 1 MAFFKSLTALSKLRSRVGQQSNLSNSVRWLQMQSSSDLDLQSHLRELIPEQQDRLK 56 >ref|XP_006482805.1| PREDICTED: citrate synthase, mitochondrial isoform X1 [Citrus sinensis] gi|568858536|ref|XP_006482806.1| PREDICTED: citrate synthase, mitochondrial isoform X2 [Citrus sinensis] Length = 471 Score = 79.0 bits (193), Expect = 6e-13 Identities = 38/56 (67%), Positives = 51/56 (91%), Gaps = 2/56 (3%) Frame = -2 Query: 164 MSFFRGLSSLAKLRSRAGQQSDLTNSVRWIQMQSSS--DLRSELQELIPQQQERLK 3 M+FFR +++L++LRSR GQQS+L+NSVRW+QMQSSS DL S+L+E+IP+QQERLK Sbjct: 1 MAFFRSVTALSRLRSRVGQQSNLSNSVRWLQMQSSSDLDLHSQLKEMIPEQQERLK 56 >ref|XP_006439016.1| hypothetical protein CICLE_v10031423mg [Citrus clementina] gi|567892993|ref|XP_006439017.1| hypothetical protein CICLE_v10031423mg [Citrus clementina] gi|557541212|gb|ESR52256.1| hypothetical protein CICLE_v10031423mg [Citrus clementina] gi|557541213|gb|ESR52257.1| hypothetical protein CICLE_v10031423mg [Citrus clementina] Length = 471 Score = 79.0 bits (193), Expect = 6e-13 Identities = 38/56 (67%), Positives = 51/56 (91%), Gaps = 2/56 (3%) Frame = -2 Query: 164 MSFFRGLSSLAKLRSRAGQQSDLTNSVRWIQMQSSS--DLRSELQELIPQQQERLK 3 M+FFR +++L++LRSR GQQS+L+NSVRW+QMQSSS DL S+L+E+IP+QQERLK Sbjct: 1 MAFFRSVTALSRLRSRVGQQSNLSNSVRWLQMQSSSDLDLHSQLKEMIPEQQERLK 56 >ref|NP_001275779.1| citrate synthase [Citrus sinensis] gi|255928569|gb|ACU42176.1| citrate synthase [Citrus sinensis] Length = 471 Score = 79.0 bits (193), Expect = 6e-13 Identities = 38/56 (67%), Positives = 51/56 (91%), Gaps = 2/56 (3%) Frame = -2 Query: 164 MSFFRGLSSLAKLRSRAGQQSDLTNSVRWIQMQSSS--DLRSELQELIPQQQERLK 3 M+FFR +++L++LRSR GQQS+L+NSVRW+QMQSSS DL S+L+E+IP+QQERLK Sbjct: 1 MAFFRSVTALSRLRSRVGQQSNLSNSVRWLQMQSSSDLDLHSQLKEMIPEQQERLK 56 >gb|AAR88248.1| mitochondrial citrate synthase precursor [Citrus junos] Length = 464 Score = 79.0 bits (193), Expect = 6e-13 Identities = 38/56 (67%), Positives = 51/56 (91%), Gaps = 2/56 (3%) Frame = -2 Query: 164 MSFFRGLSSLAKLRSRAGQQSDLTNSVRWIQMQSSS--DLRSELQELIPQQQERLK 3 M+FFR +++L++LRSR GQQS+L+NSVRW+QMQSSS DL S+L+E+IP+QQERLK Sbjct: 1 MAFFRSVTALSRLRSRVGQQSNLSNSVRWLQMQSSSDLDLHSQLKEMIPEQQERLK 56 >emb|CAA59008.1| citrate synthase [Nicotiana tabacum] Length = 469 Score = 78.6 bits (192), Expect = 8e-13 Identities = 40/56 (71%), Positives = 51/56 (91%), Gaps = 2/56 (3%) Frame = -2 Query: 164 MSFFRGLSSLAKLRSRAGQQSDLTNSVRWIQMQSSS--DLRSELQELIPQQQERLK 3 M F+RG+S L+KLRSRA QQ++L+NSVRW+Q+Q+SS DLRSELQELIP+QQ+RLK Sbjct: 1 MVFYRGVSLLSKLRSRAVQQTNLSNSVRWLQVQTSSGLDLRSELQELIPEQQDRLK 56 >ref|XP_006397611.1| hypothetical protein EUTSA_v10001384mg [Eutrema salsugineum] gi|557098684|gb|ESQ39064.1| hypothetical protein EUTSA_v10001384mg [Eutrema salsugineum] Length = 554 Score = 78.2 bits (191), Expect = 1e-12 Identities = 39/56 (69%), Positives = 48/56 (85%), Gaps = 2/56 (3%) Frame = -2 Query: 164 MSFFRGLSSLAKLRSRAGQQSDLTNSVRWIQMQSSS--DLRSELQELIPQQQERLK 3 M FFR +S+ +LRSR GQQS L+NSVRWIQMQSS+ DL+S+LQELIP+QQ+RLK Sbjct: 82 MVFFRSVSAFTRLRSRVGQQSSLSNSVRWIQMQSSTELDLKSQLQELIPEQQDRLK 137 >ref|NP_566016.1| citrate synthase 4 [Arabidopsis thaliana] gi|14423562|gb|AAK62463.1|AF387018_1 citrate synthase [Arabidopsis thaliana] gi|20197191|gb|AAC16084.2| citrate synthase [Arabidopsis thaliana] gi|30387583|gb|AAP31957.1| At2g44350 [Arabidopsis thaliana] gi|330255316|gb|AEC10410.1| citrate synthase 4 [Arabidopsis thaliana] Length = 473 Score = 78.2 bits (191), Expect = 1e-12 Identities = 39/56 (69%), Positives = 48/56 (85%), Gaps = 2/56 (3%) Frame = -2 Query: 164 MSFFRGLSSLAKLRSRAGQQSDLTNSVRWIQMQSSS--DLRSELQELIPQQQERLK 3 M FFR +S+ +LRSR GQQS L+NSVRWIQMQSS+ DL+S+LQELIP+QQ+RLK Sbjct: 1 MVFFRSVSAFTRLRSRVGQQSSLSNSVRWIQMQSSTDLDLKSQLQELIPEQQDRLK 56 >gb|AAM62868.1| citrate synthase [Arabidopsis thaliana] Length = 473 Score = 77.8 bits (190), Expect = 1e-12 Identities = 39/56 (69%), Positives = 47/56 (83%), Gaps = 2/56 (3%) Frame = -2 Query: 164 MSFFRGLSSLAKLRSRAGQQSDLTNSVRWIQMQSSS--DLRSELQELIPQQQERLK 3 M FFR +S+ +LRSR GQQS L NSVRWIQMQSS+ DL+S+LQELIP+QQ+RLK Sbjct: 1 MVFFRSVSAFTRLRSRVGQQSSLNNSVRWIQMQSSTDLDLKSQLQELIPEQQDRLK 56 >gb|ADZ05826.1| citrate synthase [Citrus maxima] Length = 471 Score = 77.8 bits (190), Expect = 1e-12 Identities = 37/56 (66%), Positives = 51/56 (91%), Gaps = 2/56 (3%) Frame = -2 Query: 164 MSFFRGLSSLAKLRSRAGQQSDLTNSVRWIQMQSSS--DLRSELQELIPQQQERLK 3 M+FFR +++L++LRSR GQQS+L+NSVRW+QMQSS+ DL S+L+E+IP+QQERLK Sbjct: 1 MAFFRSVTALSRLRSRVGQQSNLSNSVRWLQMQSSADLDLHSQLKEMIPEQQERLK 56 >gb|AFL48183.1| citrate synthase [Capsicum annuum] Length = 470 Score = 77.4 bits (189), Expect = 2e-12 Identities = 40/56 (71%), Positives = 50/56 (89%), Gaps = 2/56 (3%) Frame = -2 Query: 164 MSFFRGLSSLAKLRSRAGQQSDLTNSVRWIQMQSSS--DLRSELQELIPQQQERLK 3 M F+R +S L+KLRSRA QQS+++NSVRW+Q+QSSS DLRSELQELIP+QQ+RLK Sbjct: 1 MVFYRSVSLLSKLRSRAVQQSNVSNSVRWLQVQSSSGLDLRSELQELIPEQQDRLK 56 >ref|XP_006836545.1| hypothetical protein AMTR_s00131p00035560 [Amborella trichopoda] gi|548839084|gb|ERM99398.1| hypothetical protein AMTR_s00131p00035560 [Amborella trichopoda] Length = 480 Score = 76.6 bits (187), Expect = 3e-12 Identities = 39/58 (67%), Positives = 49/58 (84%), Gaps = 2/58 (3%) Frame = -2 Query: 170 IIMSFFRGLSSLAKLRSRAGQQSDLTNSVRWIQMQSSS--DLRSELQELIPQQQERLK 3 ++M+FFRG+SSL+KLRSR QQS L SVRW+QMQS+S DL +L+ELIP+QQERLK Sbjct: 7 LLMAFFRGVSSLSKLRSRIVQQSSLNGSVRWLQMQSASDVDLHLQLKELIPEQQERLK 64 >ref|XP_006359150.1| PREDICTED: citrate synthase, mitochondrial-like [Solanum tuberosum] Length = 470 Score = 76.3 bits (186), Expect = 4e-12 Identities = 39/56 (69%), Positives = 50/56 (89%), Gaps = 2/56 (3%) Frame = -2 Query: 164 MSFFRGLSSLAKLRSRAGQQSDLTNSVRWIQMQSSS--DLRSELQELIPQQQERLK 3 M F+R +S L+KLRSRA QQS+++NSVRW+Q+Q+SS DLRSELQELIP+QQ+RLK Sbjct: 1 MVFYRSVSLLSKLRSRAVQQSNVSNSVRWLQVQTSSGLDLRSELQELIPEQQDRLK 56 >ref|XP_004229342.1| PREDICTED: citrate synthase, mitochondrial-like [Solanum lycopersicum] Length = 470 Score = 76.3 bits (186), Expect = 4e-12 Identities = 39/56 (69%), Positives = 50/56 (89%), Gaps = 2/56 (3%) Frame = -2 Query: 164 MSFFRGLSSLAKLRSRAGQQSDLTNSVRWIQMQSSS--DLRSELQELIPQQQERLK 3 M F+R +S L+KLRSRA QQS+++NSVRW+Q+Q+SS DLRSELQELIP+QQ+RLK Sbjct: 1 MVFYRSVSLLSKLRSRAVQQSNVSNSVRWLQVQTSSGLDLRSELQELIPEQQDRLK 56 >gb|EMJ19154.1| hypothetical protein PRUPE_ppa005193mg [Prunus persica] Length = 473 Score = 73.9 bits (180), Expect = 2e-11 Identities = 37/56 (66%), Positives = 49/56 (87%), Gaps = 2/56 (3%) Frame = -2 Query: 164 MSFFRGLSSLAKLRSRAGQQSDLTNSVRWIQMQSSS--DLRSELQELIPQQQERLK 3 M FFR +++L+KLRSR GQQS+L +SVRW+Q Q+S+ DLRS+L+ELIP+QQERLK Sbjct: 1 MVFFRSVNALSKLRSRLGQQSNLRDSVRWLQTQTSTDLDLRSQLKELIPEQQERLK 56 >gb|AAL11504.1|AF367444_1 citrate synthase [Prunus persica] Length = 473 Score = 73.9 bits (180), Expect = 2e-11 Identities = 37/56 (66%), Positives = 49/56 (87%), Gaps = 2/56 (3%) Frame = -2 Query: 164 MSFFRGLSSLAKLRSRAGQQSDLTNSVRWIQMQSSS--DLRSELQELIPQQQERLK 3 M FFR +++L+KLRSR GQQS+L +SVRW+Q Q+S+ DLRS+L+ELIP+QQERLK Sbjct: 1 MVFFRSVNALSKLRSRLGQQSNLRDSVRWLQTQTSTDLDLRSQLKELIPEQQERLK 56 >ref|NP_850415.1| citrate synthase 4 [Arabidopsis thaliana] gi|41019483|sp|P20115.3|CISY4_ARATH RecName: Full=Citrate synthase 4, mitochondrial; Flags: Precursor gi|330255317|gb|AEC10411.1| citrate synthase 4 [Arabidopsis thaliana] Length = 474 Score = 73.6 bits (179), Expect = 3e-11 Identities = 39/57 (68%), Positives = 48/57 (84%), Gaps = 3/57 (5%) Frame = -2 Query: 164 MSFFRGLSSLAKLRSRA-GQQSDLTNSVRWIQMQSSS--DLRSELQELIPQQQERLK 3 M FFR +S+ +LRSR GQQS L+NSVRWIQMQSS+ DL+S+LQELIP+QQ+RLK Sbjct: 1 MVFFRSVSAFTRLRSRVQGQQSSLSNSVRWIQMQSSTDLDLKSQLQELIPEQQDRLK 57 >ref|XP_002880107.1| hypothetical protein ARALYDRAFT_483560 [Arabidopsis lyrata subsp. lyrata] gi|297325946|gb|EFH56366.1| hypothetical protein ARALYDRAFT_483560 [Arabidopsis lyrata subsp. lyrata] Length = 474 Score = 73.6 bits (179), Expect = 3e-11 Identities = 39/57 (68%), Positives = 48/57 (84%), Gaps = 3/57 (5%) Frame = -2 Query: 164 MSFFRGLSSLAKLRSRA-GQQSDLTNSVRWIQMQSSS--DLRSELQELIPQQQERLK 3 M FFR +S+ +LRSR GQQS L+NSVRWIQMQSS+ DL+S+LQELIP+QQ+RLK Sbjct: 1 MVFFRSVSAFTRLRSRVQGQQSSLSNSVRWIQMQSSTDLDLKSQLQELIPEQQDRLK 57 >sp|P49298.1|CISY_CITMA RecName: Full=Citrate synthase, mitochondrial; Flags: Precursor gi|624676|gb|AAA82743.1| citrate synthase precursor [Citrus maxima] Length = 471 Score = 73.2 bits (178), Expect = 3e-11 Identities = 36/56 (64%), Positives = 49/56 (87%), Gaps = 2/56 (3%) Frame = -2 Query: 164 MSFFRGLSSLAKLRSRAGQQSDLTNSVRWIQMQSSS--DLRSELQELIPQQQERLK 3 M+ R ++L++LRSRAGQQS+L+NSVRW+QMQSS+ DL S+L+E+IP+QQERLK Sbjct: 1 MASLRSATALSRLRSRAGQQSNLSNSVRWLQMQSSADLDLHSQLKEMIPEQQERLK 56