BLASTX nr result
ID: Achyranthes22_contig00013942
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes22_contig00013942 (350 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EMT18318.1| hypothetical protein F775_33274 [Aegilops tauschii] 58 1e-06 gb|ADX99259.1| hypersensitive induced reaction protein 2 [Tritic... 58 1e-06 gb|ACN18278.1| hypersensitive induced reaction protein 2 [Tritic... 58 1e-06 gb|AAN17463.1| hypersensitive-induced reaction protein 2 [Hordeu... 58 1e-06 gb|AAN17455.2| hypersensitive-induced reaction protein 2 [Hordeu... 58 1e-06 gb|EOY02055.1| SPFH/Band 7/PHB domain-containing membrane-associ... 58 1e-06 ref|XP_002888742.1| band 7 family protein [Arabidopsis lyrata su... 58 1e-06 ref|XP_006390957.1| hypothetical protein EUTSA_v10018966mg [Eutr... 57 2e-06 ref|XP_004297336.1| PREDICTED: hypersensitive-induced response p... 57 2e-06 gb|EXB30114.1| Hypersensitive-induced response protein 1 [Morus ... 57 3e-06 ref|NP_177142.1| Hypersensitive-induced response protein 2 [Arab... 56 4e-06 gb|AFW79371.1| hypersensitive-induced response protein [Zea mays] 56 4e-06 gb|ACG34534.1| hypersensitive-induced response protein [Zea mays] 56 4e-06 gb|ABK96731.1| unknown [Populus trichocarpa x Populus deltoides] 56 4e-06 ref|XP_002323833.1| band 7 family protein [Populus trichocarpa] ... 56 4e-06 ref|NP_001104972.1| hypersensitive induced reaction3 [Zea mays] ... 56 4e-06 dbj|BAD86819.1| hypersensitive-induced response protein [Lotus j... 56 6e-06 ref|XP_004961021.1| PREDICTED: hypersensitive-induced response p... 55 7e-06 gb|AEZ00872.1| putative hypersensitive-induced response protein,... 55 7e-06 ref|XP_003578020.1| PREDICTED: hypersensitive-induced response p... 55 7e-06 >gb|EMT18318.1| hypothetical protein F775_33274 [Aegilops tauschii] Length = 463 Score = 58.2 bits (139), Expect = 1e-06 Identities = 26/30 (86%), Positives = 29/30 (96%) Frame = -1 Query: 350 ASSVFIPHGPGAVKDIASQIRDGLLQGNTM 261 +SSVFIPHGPGAVKD+ASQIRDGLLQ NT+ Sbjct: 434 SSSVFIPHGPGAVKDVASQIRDGLLQANTL 463 >gb|ADX99259.1| hypersensitive induced reaction protein 2 [Triticum aestivum] Length = 284 Score = 58.2 bits (139), Expect = 1e-06 Identities = 26/30 (86%), Positives = 29/30 (96%) Frame = -1 Query: 350 ASSVFIPHGPGAVKDIASQIRDGLLQGNTM 261 +SSVFIPHGPGAVKD+ASQIRDGLLQ NT+ Sbjct: 255 SSSVFIPHGPGAVKDVASQIRDGLLQANTL 284 >gb|ACN18278.1| hypersensitive induced reaction protein 2 [Triticum aestivum] Length = 284 Score = 58.2 bits (139), Expect = 1e-06 Identities = 26/30 (86%), Positives = 29/30 (96%) Frame = -1 Query: 350 ASSVFIPHGPGAVKDIASQIRDGLLQGNTM 261 +SSVFIPHGPGAVKD+ASQIRDGLLQ NT+ Sbjct: 255 SSSVFIPHGPGAVKDVASQIRDGLLQANTL 284 >gb|AAN17463.1| hypersensitive-induced reaction protein 2 [Hordeum vulgare subsp. vulgare] Length = 105 Score = 58.2 bits (139), Expect = 1e-06 Identities = 26/30 (86%), Positives = 29/30 (96%) Frame = -1 Query: 350 ASSVFIPHGPGAVKDIASQIRDGLLQGNTM 261 +SSVFIPHGPGAVKD+ASQIRDGLLQ NT+ Sbjct: 76 SSSVFIPHGPGAVKDVASQIRDGLLQANTL 105 >gb|AAN17455.2| hypersensitive-induced reaction protein 2 [Hordeum vulgare subsp. vulgare] gi|326528859|dbj|BAJ97451.1| predicted protein [Hordeum vulgare subsp. vulgare] Length = 284 Score = 58.2 bits (139), Expect = 1e-06 Identities = 26/30 (86%), Positives = 29/30 (96%) Frame = -1 Query: 350 ASSVFIPHGPGAVKDIASQIRDGLLQGNTM 261 +SSVFIPHGPGAVKD+ASQIRDGLLQ NT+ Sbjct: 255 SSSVFIPHGPGAVKDVASQIRDGLLQANTL 284 >gb|EOY02055.1| SPFH/Band 7/PHB domain-containing membrane-associated protein family isoform 1 [Theobroma cacao] gi|508710159|gb|EOY02056.1| SPFH/Band 7/PHB domain-containing membrane-associated protein family isoform 1 [Theobroma cacao] Length = 285 Score = 57.8 bits (138), Expect = 1e-06 Identities = 26/31 (83%), Positives = 30/31 (96%) Frame = -1 Query: 350 ASSVFIPHGPGAVKDIASQIRDGLLQGNTME 258 ++SVFIPHGPGAV+DIASQIRDGLLQG T+E Sbjct: 255 SNSVFIPHGPGAVRDIASQIRDGLLQGRTIE 285 >ref|XP_002888742.1| band 7 family protein [Arabidopsis lyrata subsp. lyrata] gi|297334583|gb|EFH65001.1| band 7 family protein [Arabidopsis lyrata subsp. lyrata] Length = 286 Score = 57.8 bits (138), Expect = 1e-06 Identities = 26/30 (86%), Positives = 30/30 (100%) Frame = -1 Query: 350 ASSVFIPHGPGAVKDIASQIRDGLLQGNTM 261 ++SVFIPHGPGAVKDIASQIRDGLLQGN++ Sbjct: 255 SNSVFIPHGPGAVKDIASQIRDGLLQGNSV 284 >ref|XP_006390957.1| hypothetical protein EUTSA_v10018966mg [Eutrema salsugineum] gi|567123635|ref|XP_006390958.1| hypothetical protein EUTSA_v10018966mg [Eutrema salsugineum] gi|567123638|ref|XP_006390959.1| hypothetical protein EUTSA_v10018966mg [Eutrema salsugineum] gi|557087391|gb|ESQ28243.1| hypothetical protein EUTSA_v10018966mg [Eutrema salsugineum] gi|557087392|gb|ESQ28244.1| hypothetical protein EUTSA_v10018966mg [Eutrema salsugineum] gi|557087393|gb|ESQ28245.1| hypothetical protein EUTSA_v10018966mg [Eutrema salsugineum] Length = 286 Score = 57.4 bits (137), Expect = 2e-06 Identities = 26/31 (83%), Positives = 29/31 (93%) Frame = -1 Query: 350 ASSVFIPHGPGAVKDIASQIRDGLLQGNTME 258 ++SVFIPHGPGAVKDIASQIRDGLLQGN + Sbjct: 255 SNSVFIPHGPGAVKDIASQIRDGLLQGNAAD 285 >ref|XP_004297336.1| PREDICTED: hypersensitive-induced response protein 2-like [Fragaria vesca subsp. vesca] Length = 286 Score = 57.4 bits (137), Expect = 2e-06 Identities = 26/29 (89%), Positives = 29/29 (100%) Frame = -1 Query: 350 ASSVFIPHGPGAVKDIASQIRDGLLQGNT 264 ++SVFIPHGPGAVKDIASQIRDGLLQGN+ Sbjct: 255 SNSVFIPHGPGAVKDIASQIRDGLLQGNS 283 >gb|EXB30114.1| Hypersensitive-induced response protein 1 [Morus notabilis] Length = 284 Score = 56.6 bits (135), Expect = 3e-06 Identities = 26/28 (92%), Positives = 28/28 (100%) Frame = -1 Query: 350 ASSVFIPHGPGAVKDIASQIRDGLLQGN 267 +SSVFIPHGPGAVKDIASQIR+GLLQGN Sbjct: 255 SSSVFIPHGPGAVKDIASQIREGLLQGN 282 >ref|NP_177142.1| Hypersensitive-induced response protein 2 [Arabidopsis thaliana] gi|30697929|ref|NP_849870.1| Hypersensitive-induced response protein 2 [Arabidopsis thaliana] gi|42572051|ref|NP_974116.1| Hypersensitive-induced response protein 2 [Arabidopsis thaliana] gi|42572053|ref|NP_974117.1| Hypersensitive-induced response protein 2 [Arabidopsis thaliana] gi|145327201|ref|NP_001077802.1| Hypersensitive-induced response protein 2 [Arabidopsis thaliana] gi|145327203|ref|NP_001077803.1| Hypersensitive-induced response protein 2 [Arabidopsis thaliana] gi|334183794|ref|NP_001185358.1| Hypersensitive-induced response protein 2 [Arabidopsis thaliana] gi|75271990|sp|Q9CAR7.1|HIR2_ARATH RecName: Full=Hypersensitive-induced response protein 2; Short=AtHIR2 gi|12325226|gb|AAG52556.1|AC010675_4 unknown protein; 58197-59415 [Arabidopsis thaliana] gi|20466748|gb|AAM20691.1| unknown protein [Arabidopsis thaliana] gi|23198256|gb|AAN15655.1| unknown protein [Arabidopsis thaliana] gi|332196863|gb|AEE34984.1| Hypersensitive-induced response protein 2 [Arabidopsis thaliana] gi|332196864|gb|AEE34985.1| Hypersensitive-induced response protein 2 [Arabidopsis thaliana] gi|332196865|gb|AEE34986.1| Hypersensitive-induced response protein 2 [Arabidopsis thaliana] gi|332196866|gb|AEE34987.1| Hypersensitive-induced response protein 2 [Arabidopsis thaliana] gi|332196867|gb|AEE34988.1| Hypersensitive-induced response protein 2 [Arabidopsis thaliana] gi|332196868|gb|AEE34989.1| Hypersensitive-induced response protein 2 [Arabidopsis thaliana] gi|332196869|gb|AEE34990.1| Hypersensitive-induced response protein 2 [Arabidopsis thaliana] Length = 286 Score = 56.2 bits (134), Expect = 4e-06 Identities = 25/29 (86%), Positives = 29/29 (100%) Frame = -1 Query: 350 ASSVFIPHGPGAVKDIASQIRDGLLQGNT 264 ++SVFIPHGPGAV+DIASQIRDGLLQGN+ Sbjct: 255 SNSVFIPHGPGAVRDIASQIRDGLLQGNS 283 >gb|AFW79371.1| hypersensitive-induced response protein [Zea mays] Length = 333 Score = 56.2 bits (134), Expect = 4e-06 Identities = 25/32 (78%), Positives = 31/32 (96%) Frame = -1 Query: 350 ASSVFIPHGPGAVKDIASQIRDGLLQGNTMER 255 ASSVFIPHGPGAV+DIA+QIRDGLLQG+++ + Sbjct: 301 ASSVFIPHGPGAVRDIATQIRDGLLQGSSVAK 332 >gb|ACG34534.1| hypersensitive-induced response protein [Zea mays] Length = 287 Score = 56.2 bits (134), Expect = 4e-06 Identities = 25/32 (78%), Positives = 31/32 (96%) Frame = -1 Query: 350 ASSVFIPHGPGAVKDIASQIRDGLLQGNTMER 255 ASSVFIPHGPGAV+DIA+QIRDGLLQG+++ + Sbjct: 255 ASSVFIPHGPGAVRDIATQIRDGLLQGSSVAK 286 >gb|ABK96731.1| unknown [Populus trichocarpa x Populus deltoides] Length = 285 Score = 56.2 bits (134), Expect = 4e-06 Identities = 25/31 (80%), Positives = 29/31 (93%) Frame = -1 Query: 350 ASSVFIPHGPGAVKDIASQIRDGLLQGNTME 258 +SSVFIPHGPGAV+DI SQIRDGLLQGN+ + Sbjct: 255 SSSVFIPHGPGAVRDITSQIRDGLLQGNSAQ 285 >ref|XP_002323833.1| band 7 family protein [Populus trichocarpa] gi|118486431|gb|ABK95055.1| unknown [Populus trichocarpa] gi|222866835|gb|EEF03966.1| band 7 family protein [Populus trichocarpa] Length = 285 Score = 56.2 bits (134), Expect = 4e-06 Identities = 25/31 (80%), Positives = 29/31 (93%) Frame = -1 Query: 350 ASSVFIPHGPGAVKDIASQIRDGLLQGNTME 258 +SSVFIPHGPGAV+DI SQIRDGLLQGN+ + Sbjct: 255 SSSVFIPHGPGAVRDITSQIRDGLLQGNSAQ 285 >ref|NP_001104972.1| hypersensitive induced reaction3 [Zea mays] gi|7716470|gb|AAF68391.1|AF236375_1 hypersensitive-induced response protein [Zea mays] gi|194693510|gb|ACF80839.1| unknown [Zea mays] gi|194706174|gb|ACF87171.1| unknown [Zea mays] gi|195621530|gb|ACG32595.1| hypersensitive-induced response protein [Zea mays] gi|223973725|gb|ACN31050.1| unknown [Zea mays] gi|238014282|gb|ACR38176.1| unknown [Zea mays] gi|413946723|gb|AFW79372.1| hypersensitive-induced response protein isoform 1 [Zea mays] gi|413946724|gb|AFW79373.1| hypersensitive-induced response protein isoform 2 [Zea mays] gi|413946725|gb|AFW79374.1| hypersensitive-induced response protein isoform 3 [Zea mays] gi|413946726|gb|AFW79375.1| hypersensitive-induced response protein isoform 4 [Zea mays] gi|413946727|gb|AFW79376.1| hypersensitive-induced response protein isoform 5 [Zea mays] Length = 287 Score = 56.2 bits (134), Expect = 4e-06 Identities = 25/32 (78%), Positives = 31/32 (96%) Frame = -1 Query: 350 ASSVFIPHGPGAVKDIASQIRDGLLQGNTMER 255 ASSVFIPHGPGAV+DIA+QIRDGLLQG+++ + Sbjct: 255 ASSVFIPHGPGAVRDIATQIRDGLLQGSSVAK 286 >dbj|BAD86819.1| hypersensitive-induced response protein [Lotus japonicus] Length = 286 Score = 55.8 bits (133), Expect = 6e-06 Identities = 25/31 (80%), Positives = 28/31 (90%) Frame = -1 Query: 350 ASSVFIPHGPGAVKDIASQIRDGLLQGNTME 258 +++VFIPHGPGAVKDI SQIRDGLLQGN E Sbjct: 255 SNAVFIPHGPGAVKDITSQIRDGLLQGNATE 285 >ref|XP_004961021.1| PREDICTED: hypersensitive-induced response protein 1-like isoform X1 [Setaria italica] gi|514746037|ref|XP_004961022.1| PREDICTED: hypersensitive-induced response protein 1-like isoform X2 [Setaria italica] gi|514746039|ref|XP_004961023.1| PREDICTED: hypersensitive-induced response protein 1-like isoform X3 [Setaria italica] Length = 287 Score = 55.5 bits (132), Expect = 7e-06 Identities = 25/30 (83%), Positives = 29/30 (96%) Frame = -1 Query: 350 ASSVFIPHGPGAVKDIASQIRDGLLQGNTM 261 ASSVFIPHGPGAV+DIA+QIRDGLLQG+ + Sbjct: 255 ASSVFIPHGPGAVRDIATQIRDGLLQGSAV 284 >gb|AEZ00872.1| putative hypersensitive-induced response protein, partial [Elaeis guineensis] Length = 239 Score = 55.5 bits (132), Expect = 7e-06 Identities = 25/32 (78%), Positives = 30/32 (93%) Frame = -1 Query: 350 ASSVFIPHGPGAVKDIASQIRDGLLQGNTMER 255 ASSVFIPHGPGAV+DIA+QIRDGLLQ +T ++ Sbjct: 208 ASSVFIPHGPGAVRDIAAQIRDGLLQASTTQQ 239 >ref|XP_003578020.1| PREDICTED: hypersensitive-induced response protein 1-like [Brachypodium distachyon] Length = 284 Score = 55.5 bits (132), Expect = 7e-06 Identities = 25/28 (89%), Positives = 27/28 (96%) Frame = -1 Query: 350 ASSVFIPHGPGAVKDIASQIRDGLLQGN 267 +SSVFIPHGPGAVKD+ASQIRDGLLQ N Sbjct: 255 SSSVFIPHGPGAVKDVASQIRDGLLQSN 282