BLASTX nr result
ID: Achyranthes22_contig00013879
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes22_contig00013879 (883 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006857388.1| hypothetical protein AMTR_s00067p00136180 [A... 60 1e-06 >ref|XP_006857388.1| hypothetical protein AMTR_s00067p00136180 [Amborella trichopoda] gi|548861481|gb|ERN18855.1| hypothetical protein AMTR_s00067p00136180 [Amborella trichopoda] Length = 685 Score = 60.1 bits (144), Expect = 1e-06 Identities = 29/57 (50%), Positives = 36/57 (63%) Frame = +2 Query: 584 PLKKKKTSKVWIEFKQLVNETGEIKARCRHCKLVLASGSRKGTSHLKRHLFESCPKR 754 P K+K S VW EF+++ +E G +KA C+HC L S GTSHLKRHL C KR Sbjct: 60 PSKRKTISSVWDEFEKVRSEDGSVKAACKHCHRNLVGSSAHGTSHLKRHL-GRCAKR 115