BLASTX nr result
ID: Achyranthes22_contig00013839
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes22_contig00013839 (519 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EMT04509.1| Polygalacturonase inhibitor [Aegilops tauschii] 61 2e-07 dbj|BAK00896.1| predicted protein [Hordeum vulgare subsp. vulgare] 60 2e-07 gb|AFK44640.1| unknown [Medicago truncatula] 59 9e-07 ref|XP_003621816.1| Polygalacturonase inhibitor protein [Medicag... 59 9e-07 gb|ESW31014.1| hypothetical protein PHAVU_002G201600g [Phaseolus... 58 1e-06 emb|CAH10218.1| polygalacturonase inhibiting protein [Phaseolus ... 58 1e-06 ref|XP_006366353.1| PREDICTED: polygalacturonase inhibitor 2-lik... 57 2e-06 emb|CAG44505.1| polygalacturonase inhibiting protein [Pisum sati... 57 3e-06 gb|ACB30360.1| PGIP [Capsicum annuum] 56 4e-06 gb|EMT21989.1| Polygalacturonase inhibitor [Aegilops tauschii] 56 6e-06 gb|EMS63539.1| Polygalacturonase inhibitor [Triticum urartu] 56 6e-06 ref|XP_004246328.1| PREDICTED: polygalacturonase inhibitor-like ... 56 6e-06 ref|XP_004147102.1| PREDICTED: probable leucine-rich repeat rece... 55 7e-06 ref|XP_006290158.1| hypothetical protein CARUB_v10003826mg [Caps... 55 1e-05 >gb|EMT04509.1| Polygalacturonase inhibitor [Aegilops tauschii] Length = 334 Score = 60.8 bits (146), Expect = 2e-07 Identities = 23/33 (69%), Positives = 26/33 (78%) Frame = +2 Query: 2 CGQIPTGRRLKRFPPFRFAHNKCLCGAPLPPCK 100 CG +PTGR + RF + F HNKCLCGAPLPPCK Sbjct: 301 CGPVPTGRNMARFDLYNFQHNKCLCGAPLPPCK 333 >dbj|BAK00896.1| predicted protein [Hordeum vulgare subsp. vulgare] Length = 336 Score = 60.5 bits (145), Expect = 2e-07 Identities = 23/34 (67%), Positives = 26/34 (76%) Frame = +2 Query: 2 CGQIPTGRRLKRFPPFRFAHNKCLCGAPLPPCKN 103 CG +PTG + RF + F HNKCLCGAPLPPCKN Sbjct: 303 CGAVPTGGNMARFDLYNFQHNKCLCGAPLPPCKN 336 >gb|AFK44640.1| unknown [Medicago truncatula] Length = 386 Score = 58.5 bits (140), Expect = 9e-07 Identities = 23/32 (71%), Positives = 27/32 (84%) Frame = +2 Query: 2 CGQIPTGRRLKRFPPFRFAHNKCLCGAPLPPC 97 CGQIPTGRRLK+F P +F++N CLCG PLP C Sbjct: 354 CGQIPTGRRLKQFSPTKFSNNTCLCGLPLPAC 385 >ref|XP_003621816.1| Polygalacturonase inhibitor protein [Medicago truncatula] gi|355496831|gb|AES78034.1| Polygalacturonase inhibitor protein [Medicago truncatula] Length = 386 Score = 58.5 bits (140), Expect = 9e-07 Identities = 23/32 (71%), Positives = 27/32 (84%) Frame = +2 Query: 2 CGQIPTGRRLKRFPPFRFAHNKCLCGAPLPPC 97 CGQIPTGRRLK+F P +F++N CLCG PLP C Sbjct: 354 CGQIPTGRRLKQFSPTKFSNNTCLCGLPLPAC 385 >gb|ESW31014.1| hypothetical protein PHAVU_002G201600g [Phaseolus vulgaris] Length = 335 Score = 58.2 bits (139), Expect = 1e-06 Identities = 22/32 (68%), Positives = 27/32 (84%) Frame = +2 Query: 2 CGQIPTGRRLKRFPPFRFAHNKCLCGAPLPPC 97 CGQIP G +L+RF + +AHNKCLCG+PLPPC Sbjct: 303 CGQIPQGGKLQRFSEYCYAHNKCLCGSPLPPC 334 >emb|CAH10218.1| polygalacturonase inhibiting protein [Phaseolus vulgaris] gi|55859509|emb|CAI11360.1| polygalacturonase inhibiting protein precursor [Phaseolus vulgaris] Length = 335 Score = 58.2 bits (139), Expect = 1e-06 Identities = 22/32 (68%), Positives = 27/32 (84%) Frame = +2 Query: 2 CGQIPTGRRLKRFPPFRFAHNKCLCGAPLPPC 97 CGQIP G +L+RF + +AHNKCLCG+PLPPC Sbjct: 303 CGQIPQGGKLQRFSEYCYAHNKCLCGSPLPPC 334 >ref|XP_006366353.1| PREDICTED: polygalacturonase inhibitor 2-like [Solanum tuberosum] Length = 334 Score = 57.4 bits (137), Expect = 2e-06 Identities = 21/33 (63%), Positives = 26/33 (78%) Frame = +2 Query: 2 CGQIPTGRRLKRFPPFRFAHNKCLCGAPLPPCK 100 CG+IP G +K+F + + HNKCLCGAPLPPCK Sbjct: 302 CGEIPKGEYMKKFEIYEYLHNKCLCGAPLPPCK 334 >emb|CAG44505.1| polygalacturonase inhibiting protein [Pisum sativum] Length = 339 Score = 56.6 bits (135), Expect = 3e-06 Identities = 22/33 (66%), Positives = 26/33 (78%) Frame = +2 Query: 2 CGQIPTGRRLKRFPPFRFAHNKCLCGAPLPPCK 100 CGQIP G L+RF + +AHNKCLCG+PLP CK Sbjct: 306 CGQIPQGDNLRRFDEYCYAHNKCLCGSPLPACK 338 >gb|ACB30360.1| PGIP [Capsicum annuum] Length = 265 Score = 56.2 bits (134), Expect = 4e-06 Identities = 21/33 (63%), Positives = 26/33 (78%) Frame = +2 Query: 2 CGQIPTGRRLKRFPPFRFAHNKCLCGAPLPPCK 100 CG+IP G ++RF + + HNKCLCGAPLPPCK Sbjct: 233 CGKIPQGGSMQRFDQYSYFHNKCLCGAPLPPCK 265 >gb|EMT21989.1| Polygalacturonase inhibitor [Aegilops tauschii] Length = 386 Score = 55.8 bits (133), Expect = 6e-06 Identities = 21/33 (63%), Positives = 25/33 (75%) Frame = +2 Query: 2 CGQIPTGRRLKRFPPFRFAHNKCLCGAPLPPCK 100 CG +PTG ++RF + F HNKCLCGAPLP CK Sbjct: 353 CGPVPTGGNMERFDLYNFQHNKCLCGAPLPACK 385 >gb|EMS63539.1| Polygalacturonase inhibitor [Triticum urartu] Length = 243 Score = 55.8 bits (133), Expect = 6e-06 Identities = 21/33 (63%), Positives = 25/33 (75%) Frame = +2 Query: 2 CGQIPTGRRLKRFPPFRFAHNKCLCGAPLPPCK 100 CG +PTG ++RF + F HNKCLCGAPLP CK Sbjct: 210 CGPVPTGGNMERFDLYNFQHNKCLCGAPLPACK 242 >ref|XP_004246328.1| PREDICTED: polygalacturonase inhibitor-like [Solanum lycopersicum] Length = 335 Score = 55.8 bits (133), Expect = 6e-06 Identities = 20/33 (60%), Positives = 26/33 (78%) Frame = +2 Query: 2 CGQIPTGRRLKRFPPFRFAHNKCLCGAPLPPCK 100 CG+IP G +++F + + HNKCLCGAPLPPCK Sbjct: 303 CGKIPKGENMQKFEIYEYFHNKCLCGAPLPPCK 335 >ref|XP_004147102.1| PREDICTED: probable leucine-rich repeat receptor-like protein kinase At1g35710-like [Cucumis sativus] gi|449530514|ref|XP_004172240.1| PREDICTED: probable leucine-rich repeat receptor-like protein kinase At1g35710-like [Cucumis sativus] Length = 598 Score = 55.5 bits (132), Expect = 7e-06 Identities = 23/41 (56%), Positives = 26/41 (63%) Frame = +2 Query: 2 CGQIPTGRRLKRFPPFRFAHNKCLCGAPLPPCKNKM*SKLK 124 CG+IP GR FP +AHN CLCG PLPPC+ SK K Sbjct: 555 CGKIPQGRPFNVFPAAAYAHNLCLCGTPLPPCRESQESKKK 595 >ref|XP_006290158.1| hypothetical protein CARUB_v10003826mg [Capsella rubella] gi|482558864|gb|EOA23056.1| hypothetical protein CARUB_v10003826mg [Capsella rubella] Length = 332 Score = 55.1 bits (131), Expect = 1e-05 Identities = 21/33 (63%), Positives = 25/33 (75%) Frame = +2 Query: 2 CGQIPTGRRLKRFPPFRFAHNKCLCGAPLPPCK 100 CG+IP G ++RF + F HNKCLCGAPLP CK Sbjct: 300 CGRIPKGEYIQRFDSYSFLHNKCLCGAPLPSCK 332