BLASTX nr result
ID: Achyranthes22_contig00013640
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes22_contig00013640 (436 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006362703.1| PREDICTED: probable protein phosphatase 2C 7... 56 6e-06 >ref|XP_006362703.1| PREDICTED: probable protein phosphatase 2C 75-like [Solanum tuberosum] Length = 509 Score = 55.8 bits (133), Expect = 6e-06 Identities = 24/32 (75%), Positives = 30/32 (93%) Frame = +2 Query: 311 HGFFQGKKRLRQGDPMSPLLFVICMEYLSRLL 406 +G+F+GK+ LRQGDPMSPLLFV+ MEYLSR+L Sbjct: 42 YGYFEGKRGLRQGDPMSPLLFVLVMEYLSRVL 73