BLASTX nr result
ID: Achyranthes22_contig00012384
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes22_contig00012384 (202 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|BAJ07983.1| RING finger family protein [Silene latifolia] 62 8e-08 >dbj|BAJ07983.1| RING finger family protein [Silene latifolia] Length = 434 Score = 62.0 bits (149), Expect = 8e-08 Identities = 35/70 (50%), Positives = 45/70 (64%), Gaps = 5/70 (7%) Frame = +2 Query: 2 LHWRFVHRNRGSDRGALQASQTS-RANSPSSPNSYVTISLSQSSEQEDHHNVSGGTYEG- 175 ++WRF+HRNRGS+ +Q +Q S ANS S NSYVTISLS+S E ED +V + EG Sbjct: 155 MYWRFIHRNRGSE-AVVQVNQASPHANSASDQNSYVTISLSRSLEHEDRQSVPSSSNEGL 213 Query: 176 ---QNMGIAM 196 MG+ M Sbjct: 214 TANTRMGLIM 223