BLASTX nr result
ID: Achyranthes22_contig00012353
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes22_contig00012353 (453 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006352625.1| PREDICTED: protein CURVATURE THYLAKOID 1B, c... 55 1e-05 ref|XP_006444716.1| hypothetical protein CICLE_v10022571mg [Citr... 55 1e-05 ref|XP_006444714.1| hypothetical protein CICLE_v10022571mg [Citr... 55 1e-05 >ref|XP_006352625.1| PREDICTED: protein CURVATURE THYLAKOID 1B, chloroplastic-like [Solanum tuberosum] Length = 180 Score = 55.1 bits (131), Expect = 1e-05 Identities = 25/32 (78%), Positives = 27/32 (84%) Frame = -1 Query: 453 GWFAYKNLVSKTDREALILKIKNAYKDITGSS 358 GWFAYKNL+ K DREALI+KIK YKDI GSS Sbjct: 149 GWFAYKNLIFKPDREALIVKIKELYKDILGSS 180 >ref|XP_006444716.1| hypothetical protein CICLE_v10022571mg [Citrus clementina] gi|568876648|ref|XP_006491387.1| PREDICTED: protein CURVATURE THYLAKOID 1B, chloroplastic-like [Citrus sinensis] gi|557546978|gb|ESR57956.1| hypothetical protein CICLE_v10022571mg [Citrus clementina] Length = 169 Score = 55.1 bits (131), Expect = 1e-05 Identities = 26/32 (81%), Positives = 27/32 (84%) Frame = -1 Query: 453 GWFAYKNLVSKTDREALILKIKNAYKDITGSS 358 GWFAYKNLV K DREALI KIK+ YKDI GSS Sbjct: 138 GWFAYKNLVFKPDREALIQKIKDTYKDIIGSS 169 >ref|XP_006444714.1| hypothetical protein CICLE_v10022571mg [Citrus clementina] gi|557546976|gb|ESR57954.1| hypothetical protein CICLE_v10022571mg [Citrus clementina] Length = 140 Score = 55.1 bits (131), Expect = 1e-05 Identities = 26/32 (81%), Positives = 27/32 (84%) Frame = -1 Query: 453 GWFAYKNLVSKTDREALILKIKNAYKDITGSS 358 GWFAYKNLV K DREALI KIK+ YKDI GSS Sbjct: 109 GWFAYKNLVFKPDREALIQKIKDTYKDIIGSS 140