BLASTX nr result
ID: Achyranthes22_contig00012030
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes22_contig00012030 (224 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|BAM64831.1| hypothetical protein [Beta vulgaris] 55 1e-05 >dbj|BAM64831.1| hypothetical protein [Beta vulgaris] Length = 126 Score = 55.1 bits (131), Expect = 1e-05 Identities = 31/48 (64%), Positives = 36/48 (75%) Frame = +1 Query: 79 AINRNCRGLTIFGKRFVTQILTQSSISTRSISAALPTFRRCMHGSVYD 222 A N + RG+T FGKR VTQI+TQSS TR +SAA P FRR +H SVYD Sbjct: 2 AANSSYRGVTSFGKRVVTQIVTQSS-PTRPLSAA-PVFRRSLHASVYD 47