BLASTX nr result
ID: Achyranthes22_contig00011431
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes22_contig00011431 (329 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006848393.1| hypothetical protein AMTR_s00013p00217480 [A... 84 3e-14 ref|XP_006444331.1| hypothetical protein CICLE_v10021764mg [Citr... 81 2e-13 ref|XP_006444324.1| hypothetical protein CICLE_v10021764mg [Citr... 81 2e-13 ref|XP_006444320.1| hypothetical protein CICLE_v10021764mg [Citr... 81 2e-13 ref|XP_006444319.1| hypothetical protein CICLE_v10021764mg [Citr... 81 2e-13 ref|XP_006444318.1| hypothetical protein CICLE_v10021764mg [Citr... 81 2e-13 ref|XP_002523079.1| arginine/serine-rich splicing factor, putati... 80 2e-13 gb|ABR18062.1| unknown [Picea sitchensis] 80 3e-13 gb|EOX95073.1| RNA-binding family protein isoform 3 [Theobroma c... 80 4e-13 gb|EOX95072.1| RNA-binding family protein isoform 2 [Theobroma c... 80 4e-13 gb|EOX95071.1| RNA-binding family protein isoform 1 [Theobroma c... 80 4e-13 ref|XP_004136028.1| PREDICTED: pre-mRNA-splicing factor SF2-like... 80 4e-13 ref|XP_003562467.1| PREDICTED: pre-mRNA-splicing factor SF2-like... 80 4e-13 emb|CBI36847.3| unnamed protein product [Vitis vinifera] 80 4e-13 ref|XP_002265998.1| PREDICTED: pre-mRNA-splicing factor SF2-like... 80 4e-13 emb|CAN81258.1| hypothetical protein VITISV_000965 [Vitis vinifera] 80 4e-13 ref|XP_006658109.1| PREDICTED: pre-mRNA-splicing factor SF2-like... 79 6e-13 dbj|BAC79849.1| putative pre-mRNA splicing factor SF2 [Oryza sat... 79 6e-13 gb|EEE67802.1| hypothetical protein OsJ_25544 [Oryza sativa Japo... 79 6e-13 dbj|BAG97617.1| unnamed protein product [Oryza sativa Japonica G... 79 6e-13 >ref|XP_006848393.1| hypothetical protein AMTR_s00013p00217480 [Amborella trichopoda] gi|548851699|gb|ERN09974.1| hypothetical protein AMTR_s00013p00217480 [Amborella trichopoda] Length = 281 Score = 83.6 bits (205), Expect = 3e-14 Identities = 39/41 (95%), Positives = 40/41 (97%) Frame = -1 Query: 329 GTTGIVDYTNYDDMKNAIRKLDDSEFRNAFSRAYVRVKEYK 207 GTTGIVDYTNYDDMK AIRKLDDSEFRNAFSRAY+RVKEYK Sbjct: 146 GTTGIVDYTNYDDMKYAIRKLDDSEFRNAFSRAYIRVKEYK 186 >ref|XP_006444331.1| hypothetical protein CICLE_v10021764mg [Citrus clementina] gi|567903720|ref|XP_006444348.1| hypothetical protein CICLE_v10021764mg [Citrus clementina] gi|557546593|gb|ESR57571.1| hypothetical protein CICLE_v10021764mg [Citrus clementina] gi|557546610|gb|ESR57588.1| hypothetical protein CICLE_v10021764mg [Citrus clementina] Length = 275 Score = 80.9 bits (198), Expect = 2e-13 Identities = 37/40 (92%), Positives = 40/40 (100%) Frame = -1 Query: 329 GTTGIVDYTNYDDMKNAIRKLDDSEFRNAFSRAYVRVKEY 210 GTTGIVDYTNYDDMK+AI+KLDDSEFRNAFSRAYVRV+EY Sbjct: 146 GTTGIVDYTNYDDMKHAIKKLDDSEFRNAFSRAYVRVREY 185 >ref|XP_006444324.1| hypothetical protein CICLE_v10021764mg [Citrus clementina] gi|567903680|ref|XP_006444328.1| hypothetical protein CICLE_v10021764mg [Citrus clementina] gi|567903682|ref|XP_006444329.1| hypothetical protein CICLE_v10021764mg [Citrus clementina] gi|567903706|ref|XP_006444341.1| hypothetical protein CICLE_v10021764mg [Citrus clementina] gi|567903710|ref|XP_006444343.1| hypothetical protein CICLE_v10021764mg [Citrus clementina] gi|567903712|ref|XP_006444344.1| hypothetical protein CICLE_v10021764mg [Citrus clementina] gi|568852587|ref|XP_006479954.1| PREDICTED: pre-mRNA-splicing factor SF2-like isoform X2 [Citrus sinensis] gi|557546586|gb|ESR57564.1| hypothetical protein CICLE_v10021764mg [Citrus clementina] gi|557546590|gb|ESR57568.1| hypothetical protein CICLE_v10021764mg [Citrus clementina] gi|557546591|gb|ESR57569.1| hypothetical protein CICLE_v10021764mg [Citrus clementina] gi|557546603|gb|ESR57581.1| hypothetical protein CICLE_v10021764mg [Citrus clementina] gi|557546605|gb|ESR57583.1| hypothetical protein CICLE_v10021764mg [Citrus clementina] gi|557546606|gb|ESR57584.1| hypothetical protein CICLE_v10021764mg [Citrus clementina] Length = 270 Score = 80.9 bits (198), Expect = 2e-13 Identities = 37/40 (92%), Positives = 40/40 (100%) Frame = -1 Query: 329 GTTGIVDYTNYDDMKNAIRKLDDSEFRNAFSRAYVRVKEY 210 GTTGIVDYTNYDDMK+AI+KLDDSEFRNAFSRAYVRV+EY Sbjct: 146 GTTGIVDYTNYDDMKHAIKKLDDSEFRNAFSRAYVRVREY 185 >ref|XP_006444320.1| hypothetical protein CICLE_v10021764mg [Citrus clementina] gi|567903670|ref|XP_006444323.1| hypothetical protein CICLE_v10021764mg [Citrus clementina] gi|568852581|ref|XP_006479953.1| PREDICTED: pre-mRNA-splicing factor SF2-like isoform X1 [Citrus sinensis] gi|557546582|gb|ESR57560.1| hypothetical protein CICLE_v10021764mg [Citrus clementina] gi|557546585|gb|ESR57563.1| hypothetical protein CICLE_v10021764mg [Citrus clementina] Length = 299 Score = 80.9 bits (198), Expect = 2e-13 Identities = 37/40 (92%), Positives = 40/40 (100%) Frame = -1 Query: 329 GTTGIVDYTNYDDMKNAIRKLDDSEFRNAFSRAYVRVKEY 210 GTTGIVDYTNYDDMK+AI+KLDDSEFRNAFSRAYVRV+EY Sbjct: 146 GTTGIVDYTNYDDMKHAIKKLDDSEFRNAFSRAYVRVREY 185 >ref|XP_006444319.1| hypothetical protein CICLE_v10021764mg [Citrus clementina] gi|567903666|ref|XP_006444321.1| hypothetical protein CICLE_v10021764mg [Citrus clementina] gi|567903674|ref|XP_006444325.1| hypothetical protein CICLE_v10021764mg [Citrus clementina] gi|567903676|ref|XP_006444326.1| hypothetical protein CICLE_v10021764mg [Citrus clementina] gi|567903678|ref|XP_006444327.1| hypothetical protein CICLE_v10021764mg [Citrus clementina] gi|567903684|ref|XP_006444330.1| hypothetical protein CICLE_v10021764mg [Citrus clementina] gi|567903696|ref|XP_006444336.1| hypothetical protein CICLE_v10021764mg [Citrus clementina] gi|567903700|ref|XP_006444338.1| hypothetical protein CICLE_v10021764mg [Citrus clementina] gi|567903702|ref|XP_006444339.1| hypothetical protein CICLE_v10021764mg [Citrus clementina] gi|567903704|ref|XP_006444340.1| hypothetical protein CICLE_v10021764mg [Citrus clementina] gi|567903718|ref|XP_006444347.1| hypothetical protein CICLE_v10021764mg [Citrus clementina] gi|557546581|gb|ESR57559.1| hypothetical protein CICLE_v10021764mg [Citrus clementina] gi|557546583|gb|ESR57561.1| hypothetical protein CICLE_v10021764mg [Citrus clementina] gi|557546587|gb|ESR57565.1| hypothetical protein CICLE_v10021764mg [Citrus clementina] gi|557546588|gb|ESR57566.1| hypothetical protein CICLE_v10021764mg [Citrus clementina] gi|557546589|gb|ESR57567.1| hypothetical protein CICLE_v10021764mg [Citrus clementina] gi|557546592|gb|ESR57570.1| hypothetical protein CICLE_v10021764mg [Citrus clementina] gi|557546598|gb|ESR57576.1| hypothetical protein CICLE_v10021764mg [Citrus clementina] gi|557546600|gb|ESR57578.1| hypothetical protein CICLE_v10021764mg [Citrus clementina] gi|557546601|gb|ESR57579.1| hypothetical protein CICLE_v10021764mg [Citrus clementina] gi|557546602|gb|ESR57580.1| hypothetical protein CICLE_v10021764mg [Citrus clementina] gi|557546609|gb|ESR57587.1| hypothetical protein CICLE_v10021764mg [Citrus clementina] Length = 260 Score = 80.9 bits (198), Expect = 2e-13 Identities = 37/40 (92%), Positives = 40/40 (100%) Frame = -1 Query: 329 GTTGIVDYTNYDDMKNAIRKLDDSEFRNAFSRAYVRVKEY 210 GTTGIVDYTNYDDMK+AI+KLDDSEFRNAFSRAYVRV+EY Sbjct: 146 GTTGIVDYTNYDDMKHAIKKLDDSEFRNAFSRAYVRVREY 185 >ref|XP_006444318.1| hypothetical protein CICLE_v10021764mg [Citrus clementina] gi|567903668|ref|XP_006444322.1| hypothetical protein CICLE_v10021764mg [Citrus clementina] gi|567903688|ref|XP_006444332.1| hypothetical protein CICLE_v10021764mg [Citrus clementina] gi|567903690|ref|XP_006444333.1| hypothetical protein CICLE_v10021764mg [Citrus clementina] gi|567903692|ref|XP_006444334.1| hypothetical protein CICLE_v10021764mg [Citrus clementina] gi|567903694|ref|XP_006444335.1| hypothetical protein CICLE_v10021764mg [Citrus clementina] gi|567903698|ref|XP_006444337.1| hypothetical protein CICLE_v10021764mg [Citrus clementina] gi|567903708|ref|XP_006444342.1| hypothetical protein CICLE_v10021764mg [Citrus clementina] gi|567903714|ref|XP_006444345.1| hypothetical protein CICLE_v10021764mg [Citrus clementina] gi|567903716|ref|XP_006444346.1| hypothetical protein CICLE_v10021764mg [Citrus clementina] gi|557546580|gb|ESR57558.1| hypothetical protein CICLE_v10021764mg [Citrus clementina] gi|557546584|gb|ESR57562.1| hypothetical protein CICLE_v10021764mg [Citrus clementina] gi|557546594|gb|ESR57572.1| hypothetical protein CICLE_v10021764mg [Citrus clementina] gi|557546595|gb|ESR57573.1| hypothetical protein CICLE_v10021764mg [Citrus clementina] gi|557546596|gb|ESR57574.1| hypothetical protein CICLE_v10021764mg [Citrus clementina] gi|557546597|gb|ESR57575.1| hypothetical protein CICLE_v10021764mg [Citrus clementina] gi|557546599|gb|ESR57577.1| hypothetical protein CICLE_v10021764mg [Citrus clementina] gi|557546604|gb|ESR57582.1| hypothetical protein CICLE_v10021764mg [Citrus clementina] gi|557546607|gb|ESR57585.1| hypothetical protein CICLE_v10021764mg [Citrus clementina] gi|557546608|gb|ESR57586.1| hypothetical protein CICLE_v10021764mg [Citrus clementina] Length = 277 Score = 80.9 bits (198), Expect = 2e-13 Identities = 37/40 (92%), Positives = 40/40 (100%) Frame = -1 Query: 329 GTTGIVDYTNYDDMKNAIRKLDDSEFRNAFSRAYVRVKEY 210 GTTGIVDYTNYDDMK+AI+KLDDSEFRNAFSRAYVRV+EY Sbjct: 146 GTTGIVDYTNYDDMKHAIKKLDDSEFRNAFSRAYVRVREY 185 >ref|XP_002523079.1| arginine/serine-rich splicing factor, putative [Ricinus communis] gi|223537641|gb|EEF39264.1| arginine/serine-rich splicing factor, putative [Ricinus communis] Length = 292 Score = 80.5 bits (197), Expect = 2e-13 Identities = 37/40 (92%), Positives = 40/40 (100%) Frame = -1 Query: 329 GTTGIVDYTNYDDMKNAIRKLDDSEFRNAFSRAYVRVKEY 210 GTTGIVDYTNY+DMK+AI+KLDDSEFRNAFSRAYVRVKEY Sbjct: 147 GTTGIVDYTNYEDMKHAIKKLDDSEFRNAFSRAYVRVKEY 186 >gb|ABR18062.1| unknown [Picea sitchensis] Length = 331 Score = 80.1 bits (196), Expect = 3e-13 Identities = 37/40 (92%), Positives = 38/40 (95%) Frame = -1 Query: 329 GTTGIVDYTNYDDMKNAIRKLDDSEFRNAFSRAYVRVKEY 210 GTTGIVDYTNYDDMK AIRKLDDSEFRNAFSR Y+RVKEY Sbjct: 149 GTTGIVDYTNYDDMKYAIRKLDDSEFRNAFSRGYIRVKEY 188 >gb|EOX95073.1| RNA-binding family protein isoform 3 [Theobroma cacao] Length = 268 Score = 79.7 bits (195), Expect = 4e-13 Identities = 37/40 (92%), Positives = 39/40 (97%) Frame = -1 Query: 329 GTTGIVDYTNYDDMKNAIRKLDDSEFRNAFSRAYVRVKEY 210 GTTGIVDYTNYDDMK AI+KLDDSEFRNAFSRAYVRV+EY Sbjct: 146 GTTGIVDYTNYDDMKYAIKKLDDSEFRNAFSRAYVRVREY 185 >gb|EOX95072.1| RNA-binding family protein isoform 2 [Theobroma cacao] Length = 309 Score = 79.7 bits (195), Expect = 4e-13 Identities = 37/40 (92%), Positives = 39/40 (97%) Frame = -1 Query: 329 GTTGIVDYTNYDDMKNAIRKLDDSEFRNAFSRAYVRVKEY 210 GTTGIVDYTNYDDMK AI+KLDDSEFRNAFSRAYVRV+EY Sbjct: 146 GTTGIVDYTNYDDMKYAIKKLDDSEFRNAFSRAYVRVREY 185 >gb|EOX95071.1| RNA-binding family protein isoform 1 [Theobroma cacao] Length = 353 Score = 79.7 bits (195), Expect = 4e-13 Identities = 37/40 (92%), Positives = 39/40 (97%) Frame = -1 Query: 329 GTTGIVDYTNYDDMKNAIRKLDDSEFRNAFSRAYVRVKEY 210 GTTGIVDYTNYDDMK AI+KLDDSEFRNAFSRAYVRV+EY Sbjct: 146 GTTGIVDYTNYDDMKYAIKKLDDSEFRNAFSRAYVRVREY 185 >ref|XP_004136028.1| PREDICTED: pre-mRNA-splicing factor SF2-like [Cucumis sativus] gi|449498497|ref|XP_004160553.1| PREDICTED: pre-mRNA-splicing factor SF2-like [Cucumis sativus] Length = 309 Score = 79.7 bits (195), Expect = 4e-13 Identities = 37/40 (92%), Positives = 39/40 (97%) Frame = -1 Query: 329 GTTGIVDYTNYDDMKNAIRKLDDSEFRNAFSRAYVRVKEY 210 GTTGIVDYTNYDDMK AI+KLDDSEFRNAFSRAYVRV+EY Sbjct: 148 GTTGIVDYTNYDDMKYAIKKLDDSEFRNAFSRAYVRVREY 187 >ref|XP_003562467.1| PREDICTED: pre-mRNA-splicing factor SF2-like [Brachypodium distachyon] Length = 288 Score = 79.7 bits (195), Expect = 4e-13 Identities = 38/42 (90%), Positives = 39/42 (92%) Frame = -1 Query: 329 GTTGIVDYTNYDDMKNAIRKLDDSEFRNAFSRAYVRVKEYKG 204 GTTGIVDYTNYDDMK AIRKLDDSEFRNAFSRA +RVKEY G Sbjct: 150 GTTGIVDYTNYDDMKYAIRKLDDSEFRNAFSRAPIRVKEYAG 191 >emb|CBI36847.3| unnamed protein product [Vitis vinifera] Length = 264 Score = 79.7 bits (195), Expect = 4e-13 Identities = 38/40 (95%), Positives = 38/40 (95%) Frame = -1 Query: 329 GTTGIVDYTNYDDMKNAIRKLDDSEFRNAFSRAYVRVKEY 210 GT GIVDYTNYDDMK AIRKLDDSEFRNAFSRAYVRVKEY Sbjct: 148 GTVGIVDYTNYDDMKFAIRKLDDSEFRNAFSRAYVRVKEY 187 >ref|XP_002265998.1| PREDICTED: pre-mRNA-splicing factor SF2-like isoform 1 [Vitis vinifera] gi|359480272|ref|XP_003632425.1| PREDICTED: pre-mRNA-splicing factor SF2-like isoform 2 [Vitis vinifera] Length = 296 Score = 79.7 bits (195), Expect = 4e-13 Identities = 38/40 (95%), Positives = 38/40 (95%) Frame = -1 Query: 329 GTTGIVDYTNYDDMKNAIRKLDDSEFRNAFSRAYVRVKEY 210 GT GIVDYTNYDDMK AIRKLDDSEFRNAFSRAYVRVKEY Sbjct: 148 GTVGIVDYTNYDDMKFAIRKLDDSEFRNAFSRAYVRVKEY 187 >emb|CAN81258.1| hypothetical protein VITISV_000965 [Vitis vinifera] Length = 720 Score = 79.7 bits (195), Expect = 4e-13 Identities = 38/40 (95%), Positives = 38/40 (95%) Frame = -1 Query: 329 GTTGIVDYTNYDDMKNAIRKLDDSEFRNAFSRAYVRVKEY 210 GT GIVDYTNYDDMK AIRKLDDSEFRNAFSRAYVRVKEY Sbjct: 148 GTVGIVDYTNYDDMKFAIRKLDDSEFRNAFSRAYVRVKEY 187 >ref|XP_006658109.1| PREDICTED: pre-mRNA-splicing factor SF2-like isoform X1 [Oryza brachyantha] Length = 288 Score = 79.0 bits (193), Expect = 6e-13 Identities = 36/42 (85%), Positives = 39/42 (92%) Frame = -1 Query: 329 GTTGIVDYTNYDDMKNAIRKLDDSEFRNAFSRAYVRVKEYKG 204 GT GIVDYTNYDDMK AIRKLDDSEF+NAFS+AY+RVKEY G Sbjct: 145 GTIGIVDYTNYDDMKYAIRKLDDSEFKNAFSKAYIRVKEYDG 186 >dbj|BAC79849.1| putative pre-mRNA splicing factor SF2 [Oryza sativa Japonica Group] Length = 362 Score = 79.0 bits (193), Expect = 6e-13 Identities = 36/42 (85%), Positives = 39/42 (92%) Frame = -1 Query: 329 GTTGIVDYTNYDDMKNAIRKLDDSEFRNAFSRAYVRVKEYKG 204 GT GIVDYTNYDDMK AIRKLDDSEF+NAFS+AY+RVKEY G Sbjct: 211 GTIGIVDYTNYDDMKYAIRKLDDSEFKNAFSKAYIRVKEYDG 252 >gb|EEE67802.1| hypothetical protein OsJ_25544 [Oryza sativa Japonica Group] Length = 338 Score = 79.0 bits (193), Expect = 6e-13 Identities = 36/42 (85%), Positives = 39/42 (92%) Frame = -1 Query: 329 GTTGIVDYTNYDDMKNAIRKLDDSEFRNAFSRAYVRVKEYKG 204 GT GIVDYTNYDDMK AIRKLDDSEF+NAFS+AY+RVKEY G Sbjct: 211 GTIGIVDYTNYDDMKYAIRKLDDSEFKNAFSKAYIRVKEYDG 252 >dbj|BAG97617.1| unnamed protein product [Oryza sativa Japonica Group] Length = 247 Score = 79.0 bits (193), Expect = 6e-13 Identities = 36/42 (85%), Positives = 39/42 (92%) Frame = -1 Query: 329 GTTGIVDYTNYDDMKNAIRKLDDSEFRNAFSRAYVRVKEYKG 204 GT GIVDYTNYDDMK AIRKLDDSEF+NAFS+AY+RVKEY G Sbjct: 145 GTIGIVDYTNYDDMKYAIRKLDDSEFKNAFSKAYIRVKEYDG 186