BLASTX nr result
ID: Achyranthes22_contig00011325
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes22_contig00011325 (569 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ESW20829.1| hypothetical protein PHAVU_005G018100g [Phaseolus... 55 9e-06 >gb|ESW20829.1| hypothetical protein PHAVU_005G018100g [Phaseolus vulgaris] Length = 326 Score = 55.5 bits (132), Expect = 9e-06 Identities = 33/104 (31%), Positives = 41/104 (39%) Frame = -3 Query: 558 HQKP*PYCPRSPPVRTHIHPSPPSNSATLVNHHQPRQEPSGDPNPVANSLPRAHHFPLRE 379 H P P P P + HP PP + HH P + +P P HH P + Sbjct: 200 HHPPPPQTPPPPQTPSPHHPPPPQAPSP---HHPPPPQAPSPHHPPPPQAPSPHHPPPQT 256 Query: 378 PSTLHNTTSTSNQPHAHPSPSTPTFATLSPRTQQQPHTSLPRAP 247 PS H + PH PSP+ P P PH S P+AP Sbjct: 257 PSPHHPPPPQTPSPHQTPSPNYP-----PPHQTPPPHHSPPQAP 295