BLASTX nr result
ID: Achyranthes22_contig00010332
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes22_contig00010332 (315 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI39731.3| unnamed protein product [Vitis vinifera] 70 4e-10 gb|EMJ14823.1| hypothetical protein PRUPE_ppa002096mg [Prunus pe... 69 8e-10 gb|ESW18631.1| hypothetical protein PHAVU_006G057000g [Phaseolus... 68 1e-09 ref|XP_003551440.1| PREDICTED: cleavage and polyadenylation spec... 68 1e-09 ref|XP_004516100.1| PREDICTED: uncharacterized PE-PGRS family pr... 68 1e-09 ref|XP_004165306.1| PREDICTED: uncharacterized LOC101212980 [Cuc... 68 1e-09 ref|XP_004148927.1| PREDICTED: uncharacterized protein LOC101212... 68 1e-09 ref|XP_006586581.1| PREDICTED: cleavage and polyadenylation spec... 66 5e-09 gb|ESW18634.1| hypothetical protein PHAVU_006G057100g [Phaseolus... 66 5e-09 ref|XP_003551437.1| PREDICTED: cleavage and polyadenylation spec... 65 1e-08 gb|EXB36065.1| RNA-binding motif protein, X chromosome [Morus no... 63 4e-08 ref|XP_003532176.1| PREDICTED: cleavage and polyadenylation spec... 63 4e-08 ref|XP_004162742.1| PREDICTED: LOW QUALITY PROTEIN: uncharacteri... 63 5e-08 ref|XP_004148926.1| PREDICTED: uncharacterized protein LOC101212... 63 5e-08 ref|XP_002522751.1| RNA-binding protein, putative [Ricinus commu... 63 5e-08 ref|XP_006346135.1| PREDICTED: cleavage and polyadenylation spec... 62 1e-07 ref|XP_006401427.1| hypothetical protein EUTSA_v10012809mg [Eutr... 60 3e-07 ref|XP_006280096.1| hypothetical protein CARUB_v10025989mg [Caps... 60 3e-07 ref|XP_004244045.1| PREDICTED: uncharacterized protein LOC101251... 60 3e-07 gb|EOY12029.1| RNA-binding family protein isoform 1 [Theobroma c... 59 5e-07 >emb|CBI39731.3| unnamed protein product [Vitis vinifera] Length = 597 Score = 69.7 bits (169), Expect = 4e-10 Identities = 35/45 (77%), Positives = 42/45 (93%), Gaps = 2/45 (4%) Frame = -1 Query: 210 ADYEDEWER-RSSRTHSKSRVSQEEE-RPRSRDADYGKRRRITSE 82 ++++DEW+R RSSRTHSKSR+SQEEE R RSRDADYGKRRR+TSE Sbjct: 553 SEHDDEWDRGRSSRTHSKSRLSQEEEQRSRSRDADYGKRRRLTSE 597 >gb|EMJ14823.1| hypothetical protein PRUPE_ppa002096mg [Prunus persica] Length = 717 Score = 68.6 bits (166), Expect = 8e-10 Identities = 35/44 (79%), Positives = 40/44 (90%), Gaps = 2/44 (4%) Frame = -1 Query: 207 DYEDEWER-RSSRTHSKSRVSQEEER-PRSRDADYGKRRRITSE 82 ++EDEWER RSSRTHSK+RVSQE+ R RSRDADYGKRRR+TSE Sbjct: 674 EHEDEWERGRSSRTHSKARVSQEDNRRSRSRDADYGKRRRLTSE 717 >gb|ESW18631.1| hypothetical protein PHAVU_006G057000g [Phaseolus vulgaris] Length = 687 Score = 68.2 bits (165), Expect = 1e-09 Identities = 35/45 (77%), Positives = 40/45 (88%), Gaps = 2/45 (4%) Frame = -1 Query: 210 ADYEDEWER-RSSRTHSKSRVSQEEER-PRSRDADYGKRRRITSE 82 A+++DEWER RSSRTHSKSR+SQEEE R RDADYGKRRR+TSE Sbjct: 643 AEHDDEWERGRSSRTHSKSRLSQEEEHHSRPRDADYGKRRRLTSE 687 >ref|XP_003551440.1| PREDICTED: cleavage and polyadenylation specificity factor subunit CG7185-like [Glycine max] Length = 696 Score = 68.2 bits (165), Expect = 1e-09 Identities = 35/45 (77%), Positives = 40/45 (88%), Gaps = 2/45 (4%) Frame = -1 Query: 210 ADYEDEWER-RSSRTHSKSRVSQEEER-PRSRDADYGKRRRITSE 82 A+++DEWER RSSRTHSKSR+SQEEE R RDADYGKRRR+TSE Sbjct: 652 AEHDDEWERGRSSRTHSKSRLSQEEEHHSRPRDADYGKRRRLTSE 696 >ref|XP_004516100.1| PREDICTED: uncharacterized PE-PGRS family protein PE_PGRS54-like [Cicer arietinum] Length = 710 Score = 67.8 bits (164), Expect = 1e-09 Identities = 34/45 (75%), Positives = 41/45 (91%), Gaps = 2/45 (4%) Frame = -1 Query: 210 ADYEDEWER-RSSRTHSKSRVSQEEER-PRSRDADYGKRRRITSE 82 A+++DEWER RSSRTHSKSR+SQ+EE RS+DADYGKRRR+TSE Sbjct: 666 AEHDDEWERGRSSRTHSKSRLSQDEEHHSRSKDADYGKRRRLTSE 710 >ref|XP_004165306.1| PREDICTED: uncharacterized LOC101212980 [Cucumis sativus] Length = 697 Score = 67.8 bits (164), Expect = 1e-09 Identities = 34/44 (77%), Positives = 41/44 (93%), Gaps = 2/44 (4%) Frame = -1 Query: 207 DYEDEWER-RSSRTHSKSRVSQEEE-RPRSRDADYGKRRRITSE 82 +++++WER RSSRTHSKSR+SQEEE R RSRDADYGKRRR+TSE Sbjct: 654 EHDEDWERGRSSRTHSKSRLSQEEENRSRSRDADYGKRRRLTSE 697 >ref|XP_004148927.1| PREDICTED: uncharacterized protein LOC101212980 [Cucumis sativus] Length = 697 Score = 67.8 bits (164), Expect = 1e-09 Identities = 34/44 (77%), Positives = 41/44 (93%), Gaps = 2/44 (4%) Frame = -1 Query: 207 DYEDEWER-RSSRTHSKSRVSQEEE-RPRSRDADYGKRRRITSE 82 +++++WER RSSRTHSKSR+SQEEE R RSRDADYGKRRR+TSE Sbjct: 654 EHDEDWERGRSSRTHSKSRLSQEEENRSRSRDADYGKRRRLTSE 697 >ref|XP_006586581.1| PREDICTED: cleavage and polyadenylation specificity factor subunit CG7185-like [Glycine max] Length = 659 Score = 65.9 bits (159), Expect = 5e-09 Identities = 34/45 (75%), Positives = 39/45 (86%), Gaps = 2/45 (4%) Frame = -1 Query: 210 ADYEDEWER-RSSRTHSKSRVSQEEER-PRSRDADYGKRRRITSE 82 A+++DEWER RSSR HSKSR+SQEEE R RDADYGKRRR+TSE Sbjct: 615 AEHDDEWERGRSSRMHSKSRLSQEEEHHSRPRDADYGKRRRLTSE 659 >gb|ESW18634.1| hypothetical protein PHAVU_006G057100g [Phaseolus vulgaris] Length = 691 Score = 65.9 bits (159), Expect = 5e-09 Identities = 33/45 (73%), Positives = 39/45 (86%), Gaps = 2/45 (4%) Frame = -1 Query: 210 ADYEDEWER-RSSRTHSKSRVSQEEER-PRSRDADYGKRRRITSE 82 A+++DEW+R RSSRTHSK R+SQEEE R RDADYGKRRR+TSE Sbjct: 647 AEHDDEWDRGRSSRTHSKPRISQEEEHHSRPRDADYGKRRRLTSE 691 >ref|XP_003551437.1| PREDICTED: cleavage and polyadenylation specificity factor subunit CG7185-like isoform X1 [Glycine max] gi|571543924|ref|XP_006602132.1| PREDICTED: cleavage and polyadenylation specificity factor subunit CG7185-like isoform X2 [Glycine max] gi|571543928|ref|XP_006602133.1| PREDICTED: cleavage and polyadenylation specificity factor subunit CG7185-like isoform X3 [Glycine max] Length = 698 Score = 64.7 bits (156), Expect = 1e-08 Identities = 34/45 (75%), Positives = 39/45 (86%), Gaps = 2/45 (4%) Frame = -1 Query: 210 ADYEDEWER-RSSRTHSKSRVSQEEER-PRSRDADYGKRRRITSE 82 A+++DEWER RSSRTHSKSR+SQEEE R RDADY KRRR+TSE Sbjct: 654 AEHDDEWERGRSSRTHSKSRLSQEEEHHSRPRDADYVKRRRLTSE 698 >gb|EXB36065.1| RNA-binding motif protein, X chromosome [Morus notabilis] Length = 687 Score = 63.2 bits (152), Expect = 4e-08 Identities = 34/45 (75%), Positives = 40/45 (88%), Gaps = 2/45 (4%) Frame = -1 Query: 210 ADYEDEWER-RSSRTHSKSRVSQEEE-RPRSRDADYGKRRRITSE 82 A+++DEWER RSSRTH K RVSQE++ R RSRDADYGKRRR+TSE Sbjct: 644 AEHDDEWERGRSSRTH-KGRVSQEDDHRSRSRDADYGKRRRLTSE 687 >ref|XP_003532176.1| PREDICTED: cleavage and polyadenylation specificity factor subunit CG7185-like [Glycine max] Length = 693 Score = 63.2 bits (152), Expect = 4e-08 Identities = 32/45 (71%), Positives = 39/45 (86%), Gaps = 2/45 (4%) Frame = -1 Query: 210 ADYEDEWER-RSSRTHSKSRVSQEEER-PRSRDADYGKRRRITSE 82 A+++DEWER RSS+ HSKS++SQEEE R RDADYGKRRR+TSE Sbjct: 649 AEHDDEWERGRSSKPHSKSQLSQEEEHHSRPRDADYGKRRRLTSE 693 >ref|XP_004162742.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized LOC101212739 [Cucumis sativus] Length = 724 Score = 62.8 bits (151), Expect = 5e-08 Identities = 34/46 (73%), Positives = 41/46 (89%), Gaps = 4/46 (8%) Frame = -1 Query: 207 DYEDEWER-RSSRTHS--KSRVSQEEE-RPRSRDADYGKRRRITSE 82 +++++WER RSSRTHS KSR+SQEEE R RSRDADYGKRRR+TSE Sbjct: 679 EHDEDWERGRSSRTHSHSKSRLSQEEESRSRSRDADYGKRRRLTSE 724 >ref|XP_004148926.1| PREDICTED: uncharacterized protein LOC101212739 [Cucumis sativus] Length = 699 Score = 62.8 bits (151), Expect = 5e-08 Identities = 34/46 (73%), Positives = 41/46 (89%), Gaps = 4/46 (8%) Frame = -1 Query: 207 DYEDEWER-RSSRTHS--KSRVSQEEE-RPRSRDADYGKRRRITSE 82 +++++WER RSSRTHS KSR+SQEEE R RSRDADYGKRRR+TSE Sbjct: 654 EHDEDWERGRSSRTHSHSKSRLSQEEESRSRSRDADYGKRRRLTSE 699 >ref|XP_002522751.1| RNA-binding protein, putative [Ricinus communis] gi|223537989|gb|EEF39602.1| RNA-binding protein, putative [Ricinus communis] Length = 702 Score = 62.8 bits (151), Expect = 5e-08 Identities = 31/43 (72%), Positives = 39/43 (90%), Gaps = 1/43 (2%) Frame = -1 Query: 207 DYEDEWER-RSSRTHSKSRVSQEEERPRSRDADYGKRRRITSE 82 +++D+W+R RSSRTH+KSR+SQE R RSRDADYGKRRR+TSE Sbjct: 662 EHDDDWDRGRSSRTHTKSRLSQE--RSRSRDADYGKRRRLTSE 702 >ref|XP_006346135.1| PREDICTED: cleavage and polyadenylation specificity factor subunit 6-like isoform X1 [Solanum tuberosum] gi|565358644|ref|XP_006346136.1| PREDICTED: cleavage and polyadenylation specificity factor subunit 6-like isoform X2 [Solanum tuberosum] gi|565358646|ref|XP_006346137.1| PREDICTED: cleavage and polyadenylation specificity factor subunit 6-like isoform X3 [Solanum tuberosum] Length = 695 Score = 61.6 bits (148), Expect = 1e-07 Identities = 32/43 (74%), Positives = 36/43 (83%), Gaps = 1/43 (2%) Frame = -1 Query: 207 DYEDEWERRSSRTHSKSRVSQEEE-RPRSRDADYGKRRRITSE 82 +Y+DE RSSR HSKSR+S EE+ R RSRDADYGKRRRITSE Sbjct: 653 EYDDEDRGRSSRGHSKSRLSHEEDHRSRSRDADYGKRRRITSE 695 >ref|XP_006401427.1| hypothetical protein EUTSA_v10012809mg [Eutrema salsugineum] gi|557102517|gb|ESQ42880.1| hypothetical protein EUTSA_v10012809mg [Eutrema salsugineum] Length = 712 Score = 60.1 bits (144), Expect = 3e-07 Identities = 30/44 (68%), Positives = 38/44 (86%), Gaps = 2/44 (4%) Frame = -1 Query: 207 DYEDEWER-RSSRTHSKSRVSQEEE-RPRSRDADYGKRRRITSE 82 +++DEW R RSSR HSKSR+S+E+ R RSRDADYGKRRR+T+E Sbjct: 669 EHDDEWNRGRSSRGHSKSRLSREDNHRSRSRDADYGKRRRLTTE 712 >ref|XP_006280096.1| hypothetical protein CARUB_v10025989mg [Capsella rubella] gi|482548800|gb|EOA12994.1| hypothetical protein CARUB_v10025989mg [Capsella rubella] Length = 701 Score = 60.1 bits (144), Expect = 3e-07 Identities = 30/44 (68%), Positives = 38/44 (86%), Gaps = 2/44 (4%) Frame = -1 Query: 207 DYEDEWER-RSSRTHSKSRVSQEEE-RPRSRDADYGKRRRITSE 82 +++DEW R RSSR HSKSR+S+E+ R RSRDADYGKRRR+T+E Sbjct: 658 EHDDEWNRGRSSRGHSKSRLSREDNHRSRSRDADYGKRRRLTTE 701 >ref|XP_004244045.1| PREDICTED: uncharacterized protein LOC101251491 [Solanum lycopersicum] Length = 697 Score = 60.1 bits (144), Expect = 3e-07 Identities = 31/43 (72%), Positives = 36/43 (83%), Gaps = 1/43 (2%) Frame = -1 Query: 207 DYEDEWERRSSRTHSKSRVSQEEE-RPRSRDADYGKRRRITSE 82 +Y+DE RSSR HSKSR+S EE+ R RSRDADYGKR+RITSE Sbjct: 655 EYDDEDRGRSSRGHSKSRLSHEEDHRSRSRDADYGKRQRITSE 697 >gb|EOY12029.1| RNA-binding family protein isoform 1 [Theobroma cacao] gi|508720133|gb|EOY12030.1| RNA-binding family protein isoform 1 [Theobroma cacao] gi|508720134|gb|EOY12031.1| RNA-binding family protein isoform 1 [Theobroma cacao] Length = 709 Score = 59.3 bits (142), Expect = 5e-07 Identities = 31/43 (72%), Positives = 36/43 (83%), Gaps = 1/43 (2%) Frame = -1 Query: 207 DYEDEWERRSSRTHSKSRVSQEEE-RPRSRDADYGKRRRITSE 82 D E + RSSRTH++SR+SQEEE R RSRDADYGKRRR+TSE Sbjct: 667 DPEHDDHGRSSRTHNRSRLSQEEEHRSRSRDADYGKRRRLTSE 709