BLASTX nr result
ID: Achyranthes22_contig00010164
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes22_contig00010164 (322 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EOY11039.1| Winged-helix DNA-binding transcription factor fam... 67 2e-09 gb|AAM54670.1|AF514416_1 histone H1 [Lathyrus aphaca] 65 1e-08 gb|AAK29451.1|AF352248_1 histone H1 [Pisum sativum] 64 2e-08 gb|AAK29452.1|AF352249_1 histone H1 [Lathyrus sativus] 64 2e-08 gb|AAM54671.1|AF514417_1 histone H1 [Pisum abyssinicum] gi|21465... 64 2e-08 gb|AAK29453.1|AF352250_1 histone H1 [Lathyrus sativus] 64 2e-08 gb|AAK29449.1|AF352246_1 histone H1 [Pisum sativum] 64 2e-08 gb|AAK29450.1|AF352247_1 histone H1 [Pisum sativum] 64 2e-08 emb|CBI35178.3| unnamed protein product [Vitis vinifera] 64 3e-08 ref|XP_002270211.1| PREDICTED: uncharacterized protein LOC100259... 64 3e-08 emb|CAN77274.1| hypothetical protein VITISV_018553 [Vitis vinifera] 64 3e-08 ref|XP_004302064.1| PREDICTED: histone H1.2-like [Fragaria vesca... 63 4e-08 gb|EMJ03019.1| hypothetical protein PRUPE_ppa009275mg [Prunus pe... 63 4e-08 gb|AFK42964.1| unknown [Medicago truncatula] 63 4e-08 gb|AFK35979.1| unknown [Medicago truncatula] 63 4e-08 dbj|BAA78535.1| ribosome-sedimenting protein [Pisum sativum] 63 5e-08 dbj|BAA36284.1| ribosome-sedimenting protein [Pisum sativum] 63 5e-08 gb|AAP31305.1| histone H1 [Vicia faba] 63 5e-08 ref|XP_002879272.1| hypothetical protein ARALYDRAFT_481979 [Arab... 62 6e-08 emb|CBI17953.3| unnamed protein product [Vitis vinifera] 62 6e-08 >gb|EOY11039.1| Winged-helix DNA-binding transcription factor family protein [Theobroma cacao] Length = 212 Score = 67.4 bits (163), Expect = 2e-09 Identities = 33/40 (82%), Positives = 36/40 (90%) Frame = +1 Query: 1 KFIEEKHSQLPTNFRKLLLGNLKKFVASDRLVKVKASYKL 120 KFIEEKH QLP+NFRKLLL +KKFVAS +LVKVKASYKL Sbjct: 56 KFIEEKHKQLPSNFRKLLLVQMKKFVASGKLVKVKASYKL 95 >gb|AAM54670.1|AF514416_1 histone H1 [Lathyrus aphaca] Length = 298 Score = 64.7 bits (156), Expect = 1e-08 Identities = 32/40 (80%), Positives = 35/40 (87%) Frame = +1 Query: 1 KFIEEKHSQLPTNFRKLLLGNLKKFVASDRLVKVKASYKL 120 KFIEEKH QLP+NF+KLLL LKK VAS +LVKVKASYKL Sbjct: 86 KFIEEKHKQLPSNFKKLLLVQLKKLVASGKLVKVKASYKL 125 >gb|AAK29451.1|AF352248_1 histone H1 [Pisum sativum] Length = 301 Score = 64.3 bits (155), Expect = 2e-08 Identities = 31/40 (77%), Positives = 36/40 (90%) Frame = +1 Query: 1 KFIEEKHSQLPTNFRKLLLGNLKKFVASDRLVKVKASYKL 120 KFIEEKH+QLP+NF+KLLL +KK VAS +LVKVKASYKL Sbjct: 83 KFIEEKHTQLPSNFKKLLLVQIKKLVASGKLVKVKASYKL 122 >gb|AAK29452.1|AF352249_1 histone H1 [Lathyrus sativus] Length = 295 Score = 63.9 bits (154), Expect = 2e-08 Identities = 31/40 (77%), Positives = 35/40 (87%) Frame = +1 Query: 1 KFIEEKHSQLPTNFRKLLLGNLKKFVASDRLVKVKASYKL 120 KFIEEKH QLP+NF+KLLL +KK VAS +LVKVKASYKL Sbjct: 83 KFIEEKHKQLPSNFKKLLLVQIKKLVASGKLVKVKASYKL 122 >gb|AAM54671.1|AF514417_1 histone H1 [Pisum abyssinicum] gi|21465097|gb|AAM54672.1|AF514418_1 histone H1 [Pisum fulvum] Length = 295 Score = 63.9 bits (154), Expect = 2e-08 Identities = 31/40 (77%), Positives = 35/40 (87%) Frame = +1 Query: 1 KFIEEKHSQLPTNFRKLLLGNLKKFVASDRLVKVKASYKL 120 KFIEEKH QLP+NF+KLLL +KK VAS +LVKVKASYKL Sbjct: 83 KFIEEKHKQLPSNFKKLLLVQIKKLVASGKLVKVKASYKL 122 >gb|AAK29453.1|AF352250_1 histone H1 [Lathyrus sativus] Length = 306 Score = 63.9 bits (154), Expect = 2e-08 Identities = 31/40 (77%), Positives = 35/40 (87%) Frame = +1 Query: 1 KFIEEKHSQLPTNFRKLLLGNLKKFVASDRLVKVKASYKL 120 KFIEEKH QLP+NF+KLLL +KK VAS +LVKVKASYKL Sbjct: 94 KFIEEKHKQLPSNFKKLLLVQIKKLVASGKLVKVKASYKL 133 >gb|AAK29449.1|AF352246_1 histone H1 [Pisum sativum] Length = 296 Score = 63.9 bits (154), Expect = 2e-08 Identities = 31/40 (77%), Positives = 35/40 (87%) Frame = +1 Query: 1 KFIEEKHSQLPTNFRKLLLGNLKKFVASDRLVKVKASYKL 120 KFIEEKH QLP+NF+KLLL +KK VAS +LVKVKASYKL Sbjct: 83 KFIEEKHKQLPSNFKKLLLVQIKKLVASGKLVKVKASYKL 122 >gb|AAK29450.1|AF352247_1 histone H1 [Pisum sativum] Length = 290 Score = 63.9 bits (154), Expect = 2e-08 Identities = 31/40 (77%), Positives = 35/40 (87%) Frame = +1 Query: 1 KFIEEKHSQLPTNFRKLLLGNLKKFVASDRLVKVKASYKL 120 KFIEEKH QLP+NF+KLLL +KK VAS +LVKVKASYKL Sbjct: 83 KFIEEKHKQLPSNFKKLLLVQIKKLVASGKLVKVKASYKL 122 >emb|CBI35178.3| unnamed protein product [Vitis vinifera] Length = 177 Score = 63.5 bits (153), Expect = 3e-08 Identities = 31/40 (77%), Positives = 36/40 (90%) Frame = +1 Query: 1 KFIEEKHSQLPTNFRKLLLGNLKKFVASDRLVKVKASYKL 120 KFIEEKH +LP+NFRKLLL +LKK VAS++LVKVK SYKL Sbjct: 86 KFIEEKHKKLPSNFRKLLLVHLKKLVASEKLVKVKNSYKL 125 >ref|XP_002270211.1| PREDICTED: uncharacterized protein LOC100259836 [Vitis vinifera] Length = 290 Score = 63.5 bits (153), Expect = 3e-08 Identities = 31/40 (77%), Positives = 36/40 (90%) Frame = +1 Query: 1 KFIEEKHSQLPTNFRKLLLGNLKKFVASDRLVKVKASYKL 120 KFIEEKH +LP+NFRKLLL +LKK VAS++LVKVK SYKL Sbjct: 86 KFIEEKHKKLPSNFRKLLLVHLKKLVASEKLVKVKNSYKL 125 >emb|CAN77274.1| hypothetical protein VITISV_018553 [Vitis vinifera] Length = 290 Score = 63.5 bits (153), Expect = 3e-08 Identities = 31/40 (77%), Positives = 36/40 (90%) Frame = +1 Query: 1 KFIEEKHSQLPTNFRKLLLGNLKKFVASDRLVKVKASYKL 120 KFIEEKH +LP+NFRKLLL +LKK VAS++LVKVK SYKL Sbjct: 86 KFIEEKHKKLPSNFRKLLLVHLKKLVASEKLVKVKNSYKL 125 >ref|XP_004302064.1| PREDICTED: histone H1.2-like [Fragaria vesca subsp. vesca] Length = 218 Score = 63.2 bits (152), Expect = 4e-08 Identities = 31/40 (77%), Positives = 35/40 (87%) Frame = +1 Query: 1 KFIEEKHSQLPTNFRKLLLGNLKKFVASDRLVKVKASYKL 120 KF+EEKH QLP +FRKLLL NLKK VAS +LVKVKAS+KL Sbjct: 44 KFVEEKHKQLPQSFRKLLLLNLKKLVASGKLVKVKASFKL 83 >gb|EMJ03019.1| hypothetical protein PRUPE_ppa009275mg [Prunus persica] Length = 299 Score = 63.2 bits (152), Expect = 4e-08 Identities = 30/40 (75%), Positives = 36/40 (90%) Frame = +1 Query: 1 KFIEEKHSQLPTNFRKLLLGNLKKFVASDRLVKVKASYKL 120 KFIEEKH QLP NF+KLLL +LKK V+SD+LVKVK+S+KL Sbjct: 88 KFIEEKHKQLPPNFKKLLLYHLKKLVSSDKLVKVKSSFKL 127 >gb|AFK42964.1| unknown [Medicago truncatula] Length = 254 Score = 63.2 bits (152), Expect = 4e-08 Identities = 31/40 (77%), Positives = 35/40 (87%) Frame = +1 Query: 1 KFIEEKHSQLPTNFRKLLLGNLKKFVASDRLVKVKASYKL 120 KFIEEKH QLP+NF+KLLL NLKK VAS +LVKVK S+KL Sbjct: 90 KFIEEKHKQLPSNFKKLLLQNLKKNVASGKLVKVKGSFKL 129 >gb|AFK35979.1| unknown [Medicago truncatula] Length = 248 Score = 63.2 bits (152), Expect = 4e-08 Identities = 31/40 (77%), Positives = 35/40 (87%) Frame = +1 Query: 1 KFIEEKHSQLPTNFRKLLLGNLKKFVASDRLVKVKASYKL 120 KFIEEKH QLP+NF+KLLL NLKK VAS +LVKVK S+KL Sbjct: 90 KFIEEKHKQLPSNFKKLLLQNLKKNVASGKLVKVKGSFKL 129 >dbj|BAA78535.1| ribosome-sedimenting protein [Pisum sativum] Length = 297 Score = 62.8 bits (151), Expect = 5e-08 Identities = 30/40 (75%), Positives = 35/40 (87%) Frame = +1 Query: 1 KFIEEKHSQLPTNFRKLLLGNLKKFVASDRLVKVKASYKL 120 KFIEEKH QLP+NF+KLLL ++K VAS +LVKVKASYKL Sbjct: 85 KFIEEKHKQLPSNFKKLLLVQIRKLVASGKLVKVKASYKL 124 >dbj|BAA36284.1| ribosome-sedimenting protein [Pisum sativum] Length = 295 Score = 62.8 bits (151), Expect = 5e-08 Identities = 30/40 (75%), Positives = 35/40 (87%) Frame = +1 Query: 1 KFIEEKHSQLPTNFRKLLLGNLKKFVASDRLVKVKASYKL 120 KFIEEKH QLP+NF+KLLL ++K VAS +LVKVKASYKL Sbjct: 83 KFIEEKHKQLPSNFKKLLLVQIRKLVASGKLVKVKASYKL 122 >gb|AAP31305.1| histone H1 [Vicia faba] Length = 278 Score = 62.8 bits (151), Expect = 5e-08 Identities = 29/40 (72%), Positives = 35/40 (87%) Frame = +1 Query: 1 KFIEEKHSQLPTNFRKLLLGNLKKFVASDRLVKVKASYKL 120 KFIEEKH LP+NF+K+LL L+K VASD+LVKVKASYK+ Sbjct: 83 KFIEEKHKNLPSNFKKILLVQLRKLVASDKLVKVKASYKI 122 >ref|XP_002879272.1| hypothetical protein ARALYDRAFT_481979 [Arabidopsis lyrata subsp. lyrata] gi|297325111|gb|EFH55531.1| hypothetical protein ARALYDRAFT_481979 [Arabidopsis lyrata subsp. lyrata] Length = 264 Score = 62.4 bits (150), Expect = 6e-08 Identities = 29/40 (72%), Positives = 35/40 (87%) Frame = +1 Query: 1 KFIEEKHSQLPTNFRKLLLGNLKKFVASDRLVKVKASYKL 120 KFIEEKH LP NFRK+LL NLK+ VAS++LVKVKAS+K+ Sbjct: 85 KFIEEKHKSLPPNFRKILLVNLKRLVASEKLVKVKASFKI 124 >emb|CBI17953.3| unnamed protein product [Vitis vinifera] Length = 225 Score = 62.4 bits (150), Expect = 6e-08 Identities = 30/40 (75%), Positives = 35/40 (87%) Frame = +1 Query: 1 KFIEEKHSQLPTNFRKLLLGNLKKFVASDRLVKVKASYKL 120 KFIEEKH QLP NF+KLLL +LKKFVA+ +LVKV+ SYKL Sbjct: 83 KFIEEKHKQLPPNFKKLLLIHLKKFVAAGKLVKVRGSYKL 122