BLASTX nr result
ID: Achyranthes22_contig00010118
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes22_contig00010118 (698 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006424532.1| hypothetical protein CICLE_v10029727mg [Citr... 56 1e-05 >ref|XP_006424532.1| hypothetical protein CICLE_v10029727mg [Citrus clementina] gi|557526466|gb|ESR37772.1| hypothetical protein CICLE_v10029727mg [Citrus clementina] Length = 77 Score = 56.2 bits (134), Expect = 1e-05 Identities = 28/64 (43%), Positives = 43/64 (67%), Gaps = 1/64 (1%) Frame = +1 Query: 121 KVQTVAIMIILLIFSPAVLLTNGRGLS-ENHSPRMMSQFDDNTNSGYYESSTHNHHEIPR 297 K++ + + ++L+I S + L NGR L+ E + R++S+ D N SGY S+ +NHH IPR Sbjct: 4 KMRLLGLALVLMILS-SCLAANGRALNAETYDSRVLSEGDPNVKSGYPPSNVNNHHYIPR 62 Query: 298 QDFN 309 QDFN Sbjct: 63 QDFN 66