BLASTX nr result
ID: Achyranthes22_contig00008540
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes22_contig00008540 (1568 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002531185.1| RSI-1 protein precursor, putative [Ricinus c... 59 7e-06 gb|AGM20679.1| GASA5 [Populus tomentosa] 58 1e-05 ref|XP_004490815.1| PREDICTED: protein RSI-1-like [Cicer arietinum] 58 1e-05 ref|XP_002301708.1| predicted protein [Populus trichocarpa] gi|5... 58 1e-05 >ref|XP_002531185.1| RSI-1 protein precursor, putative [Ricinus communis] gi|223529226|gb|EEF31200.1| RSI-1 protein precursor, putative [Ricinus communis] Length = 95 Score = 58.5 bits (140), Expect = 7e-06 Identities = 26/50 (52%), Positives = 28/50 (56%) Frame = +3 Query: 1419 YDIGFHESDCRPRCNYRCSATSHRKPXXXXXXXXXXXXXXVPAGTYGNKQ 1568 Y F SDC+PRC YRCSATSH+KP VP G YGNKQ Sbjct: 28 YGSRFRPSDCKPRCTYRCSATSHKKPCMFFCLKCCSKCLCVPPGVYGNKQ 77 >gb|AGM20679.1| GASA5 [Populus tomentosa] Length = 95 Score = 58.2 bits (139), Expect = 1e-05 Identities = 25/53 (47%), Positives = 31/53 (58%) Frame = +3 Query: 1410 SSIYDIGFHESDCRPRCNYRCSATSHRKPXXXXXXXXXXXXXXVPAGTYGNKQ 1568 + I+ S+C+PRCNYRCSATSH+KP VP GTYGNK+ Sbjct: 25 AEIHGAKLRPSECKPRCNYRCSATSHKKPCMFFCLKCCATCLCVPPGTYGNKE 77 >ref|XP_004490815.1| PREDICTED: protein RSI-1-like [Cicer arietinum] Length = 95 Score = 58.2 bits (139), Expect = 1e-05 Identities = 25/43 (58%), Positives = 28/43 (65%) Frame = +3 Query: 1440 SDCRPRCNYRCSATSHRKPXXXXXXXXXXXXXXVPAGTYGNKQ 1568 SDC+PRC+YRCSATSH+KP VP GTYGNKQ Sbjct: 35 SDCKPRCSYRCSATSHKKPCMFFCQKCCATCLCVPPGTYGNKQ 77 >ref|XP_002301708.1| predicted protein [Populus trichocarpa] gi|566171373|ref|XP_006383339.1| gibberellin-regulated protein 5 [Populus trichocarpa] gi|550338948|gb|ERP61136.1| gibberellin-regulated protein 5 [Populus trichocarpa] Length = 95 Score = 58.2 bits (139), Expect = 1e-05 Identities = 25/53 (47%), Positives = 31/53 (58%) Frame = +3 Query: 1410 SSIYDIGFHESDCRPRCNYRCSATSHRKPXXXXXXXXXXXXXXVPAGTYGNKQ 1568 + I+ S+C+PRCNYRCSATSH+KP VP GTYGNK+ Sbjct: 25 AEIHGAKLRPSECKPRCNYRCSATSHKKPCMFFCLKCCATCLCVPPGTYGNKE 77