BLASTX nr result
ID: Achyranthes22_contig00008085
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes22_contig00008085 (212 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ABJ99599.1| NBS-LRR type resistance protein [Beta vulgaris] 58 1e-06 emb|CAJ44366.1| putative CC-NBS-LRR resistance protein [Malus do... 56 6e-06 >gb|ABJ99599.1| NBS-LRR type resistance protein [Beta vulgaris] Length = 1067 Score = 58.2 bits (139), Expect = 1e-06 Identities = 31/60 (51%), Positives = 39/60 (65%), Gaps = 3/60 (5%) Frame = +1 Query: 7 GILDDEG---VLSLMEILHPHSNLKVLKIRDYEGTRMPDWASYHLPNLVQLQLYYCKKLE 177 G +DD ++SL+E L PHSNLK L++ YEG RMPDW + LP+LV L L C LE Sbjct: 744 GKIDDVSQGTIISLIEDLQPHSNLKELEVSGYEGVRMPDWINL-LPDLVHLYLQECTNLE 802 >emb|CAJ44366.1| putative CC-NBS-LRR resistance protein [Malus domestica] Length = 955 Score = 55.8 bits (133), Expect = 6e-06 Identities = 25/55 (45%), Positives = 35/55 (63%) Frame = +1 Query: 13 LDDEGVLSLMEILHPHSNLKVLKIRDYEGTRMPDWASYHLPNLVQLQLYYCKKLE 177 +D+E ++ ME+L PHSNLK L + DY G R W S L N+V L+L YC + + Sbjct: 754 VDEEDIIKSMEVLQPHSNLKQLSVYDYSGVRFASWFS-SLINIVNLELRYCNRCQ 807