BLASTX nr result
ID: Achyranthes22_contig00006375
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes22_contig00006375 (861 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AEZ36038.1| KU70, partial [Nicotiana benthamiana] 57 7e-06 >gb|AEZ36038.1| KU70, partial [Nicotiana benthamiana] Length = 113 Score = 57.4 bits (137), Expect = 7e-06 Identities = 30/45 (66%), Positives = 32/45 (71%) Frame = +1 Query: 421 SNVNAGFKLKDLTVAELIYYLTAHKLAVTGKK*ALINRILTRMNK 555 S N KLKDLTV EL YYL AH + VTGKK ALI+RILT M K Sbjct: 69 SMTNLPLKLKDLTVVELKYYLAAHNIPVTGKKEALISRILTHMGK 113