BLASTX nr result
ID: Achyranthes22_contig00006067
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes22_contig00006067 (1961 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006369198.1| hypothetical protein POPTR_0001s18670g [Popu... 63 5e-07 gb|EXB74539.1| Peroxisome biogenesis protein 2 [Morus notabilis] 62 7e-07 ref|XP_006585585.1| PREDICTED: peroxisome biogenesis protein 2-l... 62 9e-07 ref|XP_006583060.1| PREDICTED: peroxisome biogenesis protein 2-l... 62 9e-07 ref|XP_006583059.1| PREDICTED: peroxisome biogenesis protein 2-l... 62 9e-07 ref|XP_006583058.1| PREDICTED: peroxisome biogenesis protein 2-l... 62 9e-07 gb|ESW07654.1| hypothetical protein PHAVU_010G1475000g, partial ... 62 9e-07 ref|XP_003531663.1| PREDICTED: peroxisome biogenesis protein 2-l... 62 9e-07 ref|XP_003530139.1| PREDICTED: peroxisome biogenesis protein 2-l... 62 9e-07 gb|ACF80446.1| unknown [Zea mays] gi|414868903|tpg|DAA47460.1| T... 62 9e-07 ref|NP_001131851.1| peroxisome assembly factor 1 isoform 1 [Zea ... 62 9e-07 ref|XP_004516308.1| PREDICTED: peroxisome biogenesis protein 2-l... 62 1e-06 ref|XP_003626977.1| Peroxisome assembly protein [Medicago trunca... 62 1e-06 gb|ACN35378.1| unknown [Zea mays] 62 1e-06 ref|XP_002279072.1| PREDICTED: peroxisome biogenesis protein 2 [... 62 1e-06 ref|XP_006465640.1| PREDICTED: peroxisome biogenesis protein 2-l... 61 2e-06 ref|XP_006356146.1| PREDICTED: peroxisome biogenesis protein 2-l... 61 2e-06 ref|XP_006426929.1| hypothetical protein CICLE_v10026026mg [Citr... 61 2e-06 ref|XP_004302885.1| PREDICTED: peroxisome biogenesis protein 2-l... 61 2e-06 gb|EMJ16856.1| hypothetical protein PRUPE_ppa008363mg [Prunus pe... 61 2e-06 >ref|XP_006369198.1| hypothetical protein POPTR_0001s18670g [Populus trichocarpa] gi|550347629|gb|ERP65767.1| hypothetical protein POPTR_0001s18670g [Populus trichocarpa] Length = 251 Score = 62.8 bits (151), Expect = 5e-07 Identities = 31/51 (60%), Positives = 38/51 (74%) Frame = -3 Query: 726 RHRSLIERDVRVRLVYGSPKMDSSFSFVYMNRQLVWNEFLVIFYCDFFACQ 574 R R+LIER ++ RLVYGSP M+ + SF YMNRQLVWNEF V +F+CQ Sbjct: 204 RFRNLIERVLQARLVYGSPNMNRAVSFEYMNRQLVWNEFSV----TYFSCQ 250 >gb|EXB74539.1| Peroxisome biogenesis protein 2 [Morus notabilis] Length = 334 Score = 62.4 bits (150), Expect = 7e-07 Identities = 30/56 (53%), Positives = 40/56 (71%) Frame = -3 Query: 777 FHCSKGFVVLCVMNF*CRHRSLIERDVRVRLVYGSPKMDSSFSFVYMNRQLVWNEF 610 F+ + F L + + ++R+LIER +R RLVYGSP M+ + SF YMNRQLVWNEF Sbjct: 182 FYKAASFGNLLIFLYTGKYRNLIERALRARLVYGSPNMNRAVSFEYMNRQLVWNEF 237 >ref|XP_006585585.1| PREDICTED: peroxisome biogenesis protein 2-like isoform X2 [Glycine max] Length = 329 Score = 62.0 bits (149), Expect = 9e-07 Identities = 28/39 (71%), Positives = 33/39 (84%) Frame = -3 Query: 726 RHRSLIERDVRVRLVYGSPKMDSSFSFVYMNRQLVWNEF 610 R+R+LIER +R RLVYGSP M+ + SF YMNRQLVWNEF Sbjct: 197 RYRNLIERALRARLVYGSPNMNRAVSFEYMNRQLVWNEF 235 >ref|XP_006583060.1| PREDICTED: peroxisome biogenesis protein 2-like isoform X5 [Glycine max] Length = 330 Score = 62.0 bits (149), Expect = 9e-07 Identities = 28/39 (71%), Positives = 33/39 (84%) Frame = -3 Query: 726 RHRSLIERDVRVRLVYGSPKMDSSFSFVYMNRQLVWNEF 610 R+R+LIER +R RLVYGSP M+ + SF YMNRQLVWNEF Sbjct: 198 RYRNLIERALRARLVYGSPNMNRAVSFEYMNRQLVWNEF 236 >ref|XP_006583059.1| PREDICTED: peroxisome biogenesis protein 2-like isoform X4 [Glycine max] Length = 332 Score = 62.0 bits (149), Expect = 9e-07 Identities = 28/39 (71%), Positives = 33/39 (84%) Frame = -3 Query: 726 RHRSLIERDVRVRLVYGSPKMDSSFSFVYMNRQLVWNEF 610 R+R+LIER +R RLVYGSP M+ + SF YMNRQLVWNEF Sbjct: 200 RYRNLIERALRARLVYGSPNMNRAVSFEYMNRQLVWNEF 238 >ref|XP_006583058.1| PREDICTED: peroxisome biogenesis protein 2-like isoform X3 [Glycine max] Length = 333 Score = 62.0 bits (149), Expect = 9e-07 Identities = 28/39 (71%), Positives = 33/39 (84%) Frame = -3 Query: 726 RHRSLIERDVRVRLVYGSPKMDSSFSFVYMNRQLVWNEF 610 R+R+LIER +R RLVYGSP M+ + SF YMNRQLVWNEF Sbjct: 201 RYRNLIERALRARLVYGSPNMNRAVSFEYMNRQLVWNEF 239 >gb|ESW07654.1| hypothetical protein PHAVU_010G1475000g, partial [Phaseolus vulgaris] Length = 244 Score = 62.0 bits (149), Expect = 9e-07 Identities = 28/39 (71%), Positives = 33/39 (84%) Frame = -3 Query: 726 RHRSLIERDVRVRLVYGSPKMDSSFSFVYMNRQLVWNEF 610 R+R+LIER +R RLVYGSP M+ + SF YMNRQLVWNEF Sbjct: 112 RYRNLIERALRARLVYGSPNMNRAVSFEYMNRQLVWNEF 150 >ref|XP_003531663.1| PREDICTED: peroxisome biogenesis protein 2-like isoform X1 [Glycine max] Length = 330 Score = 62.0 bits (149), Expect = 9e-07 Identities = 28/39 (71%), Positives = 33/39 (84%) Frame = -3 Query: 726 RHRSLIERDVRVRLVYGSPKMDSSFSFVYMNRQLVWNEF 610 R+R+LIER +R RLVYGSP M+ + SF YMNRQLVWNEF Sbjct: 198 RYRNLIERALRARLVYGSPNMNRAVSFEYMNRQLVWNEF 236 >ref|XP_003530139.1| PREDICTED: peroxisome biogenesis protein 2-like isoformX2 [Glycine max] Length = 331 Score = 62.0 bits (149), Expect = 9e-07 Identities = 28/39 (71%), Positives = 33/39 (84%) Frame = -3 Query: 726 RHRSLIERDVRVRLVYGSPKMDSSFSFVYMNRQLVWNEF 610 R+R+LIER +R RLVYGSP M+ + SF YMNRQLVWNEF Sbjct: 199 RYRNLIERALRARLVYGSPNMNRAVSFEYMNRQLVWNEF 237 >gb|ACF80446.1| unknown [Zea mays] gi|414868903|tpg|DAA47460.1| TPA: hypothetical protein ZEAMMB73_352962 [Zea mays] gi|414868904|tpg|DAA47461.1| TPA: hypothetical protein ZEAMMB73_352962 [Zea mays] gi|414868905|tpg|DAA47462.1| TPA: hypothetical protein ZEAMMB73_352962 [Zea mays] Length = 226 Score = 62.0 bits (149), Expect = 9e-07 Identities = 29/60 (48%), Positives = 42/60 (70%) Frame = -3 Query: 789 NCFVFHCSKGFVVLCVMNF*CRHRSLIERDVRVRLVYGSPKMDSSFSFVYMNRQLVWNEF 610 N VF+ + F L + + R+++++ER ++ RLVYGSP M+ + SF YMNRQLVWNEF Sbjct: 76 NAEVFYRAASFFNLLLFLYGGRYKTVVERILKARLVYGSPNMNRAVSFEYMNRQLVWNEF 135 >ref|NP_001131851.1| peroxisome assembly factor 1 isoform 1 [Zea mays] gi|194691554|gb|ACF79861.1| unknown [Zea mays] gi|195634725|gb|ACG36831.1| peroxisome assembly factor 1 [Zea mays] gi|414868906|tpg|DAA47463.1| TPA: peroxisome assembly factor 1 isoform 1 [Zea mays] gi|414868907|tpg|DAA47464.1| TPA: peroxisome assembly factor 1 isoform 2 [Zea mays] Length = 337 Score = 62.0 bits (149), Expect = 9e-07 Identities = 29/60 (48%), Positives = 42/60 (70%) Frame = -3 Query: 789 NCFVFHCSKGFVVLCVMNF*CRHRSLIERDVRVRLVYGSPKMDSSFSFVYMNRQLVWNEF 610 N VF+ + F L + + R+++++ER ++ RLVYGSP M+ + SF YMNRQLVWNEF Sbjct: 187 NAEVFYRAASFFNLLLFLYGGRYKTVVERILKARLVYGSPNMNRAVSFEYMNRQLVWNEF 246 >ref|XP_004516308.1| PREDICTED: peroxisome biogenesis protein 2-like [Cicer arietinum] Length = 335 Score = 61.6 bits (148), Expect = 1e-06 Identities = 28/39 (71%), Positives = 33/39 (84%) Frame = -3 Query: 726 RHRSLIERDVRVRLVYGSPKMDSSFSFVYMNRQLVWNEF 610 R+R+LIER +R RLVYGSP M+ + SF YMNRQLVWNEF Sbjct: 203 RYRNLIERVLRARLVYGSPNMNRAVSFEYMNRQLVWNEF 241 >ref|XP_003626977.1| Peroxisome assembly protein [Medicago truncatula] gi|355520999|gb|AET01453.1| Peroxisome assembly protein [Medicago truncatula] Length = 438 Score = 61.6 bits (148), Expect = 1e-06 Identities = 28/39 (71%), Positives = 33/39 (84%) Frame = -3 Query: 726 RHRSLIERDVRVRLVYGSPKMDSSFSFVYMNRQLVWNEF 610 R+R+LIER +R RLVYGSP M+ + SF YMNRQLVWNEF Sbjct: 306 RYRNLIERVLRARLVYGSPNMNRAVSFEYMNRQLVWNEF 344 >gb|ACN35378.1| unknown [Zea mays] Length = 337 Score = 61.6 bits (148), Expect = 1e-06 Identities = 29/60 (48%), Positives = 42/60 (70%) Frame = -3 Query: 789 NCFVFHCSKGFVVLCVMNF*CRHRSLIERDVRVRLVYGSPKMDSSFSFVYMNRQLVWNEF 610 N VF+ + F L + + R+++++ER ++ RLVYGSP M+ + SF YMNRQLVWNEF Sbjct: 187 NAEVFYRAVSFFNLLLFLYGGRYKTVVERILKARLVYGSPNMNRAVSFEYMNRQLVWNEF 246 >ref|XP_002279072.1| PREDICTED: peroxisome biogenesis protein 2 [Vitis vinifera] gi|297743241|emb|CBI36108.3| unnamed protein product [Vitis vinifera] Length = 346 Score = 61.6 bits (148), Expect = 1e-06 Identities = 30/50 (60%), Positives = 37/50 (74%) Frame = -3 Query: 759 FVVLCVMNF*CRHRSLIERDVRVRLVYGSPKMDSSFSFVYMNRQLVWNEF 610 F L + F R+R+LIER ++ RLVYGSP M+ + SF YMNRQLVWNEF Sbjct: 198 FSNLLIFLFTGRYRNLIERALQARLVYGSPNMNRAVSFEYMNRQLVWNEF 247 >ref|XP_006465640.1| PREDICTED: peroxisome biogenesis protein 2-like [Citrus sinensis] Length = 335 Score = 60.8 bits (146), Expect = 2e-06 Identities = 27/39 (69%), Positives = 33/39 (84%) Frame = -3 Query: 726 RHRSLIERDVRVRLVYGSPKMDSSFSFVYMNRQLVWNEF 610 R+R+LIER +R RLVYG+P M+ + SF YMNRQLVWNEF Sbjct: 199 RYRNLIERALRARLVYGTPNMNRAVSFEYMNRQLVWNEF 237 >ref|XP_006356146.1| PREDICTED: peroxisome biogenesis protein 2-like [Solanum tuberosum] Length = 350 Score = 60.8 bits (146), Expect = 2e-06 Identities = 28/39 (71%), Positives = 32/39 (82%) Frame = -3 Query: 726 RHRSLIERDVRVRLVYGSPKMDSSFSFVYMNRQLVWNEF 610 R R+LIER +R RLVYGSP M+ + SF YMNRQLVWNEF Sbjct: 216 RFRNLIERALRARLVYGSPNMNRAVSFEYMNRQLVWNEF 254 >ref|XP_006426929.1| hypothetical protein CICLE_v10026026mg [Citrus clementina] gi|557528919|gb|ESR40169.1| hypothetical protein CICLE_v10026026mg [Citrus clementina] Length = 335 Score = 60.8 bits (146), Expect = 2e-06 Identities = 27/39 (69%), Positives = 33/39 (84%) Frame = -3 Query: 726 RHRSLIERDVRVRLVYGSPKMDSSFSFVYMNRQLVWNEF 610 R+R+LIER +R RLVYG+P M+ + SF YMNRQLVWNEF Sbjct: 199 RYRNLIERALRARLVYGTPNMNRAVSFEYMNRQLVWNEF 237 >ref|XP_004302885.1| PREDICTED: peroxisome biogenesis protein 2-like [Fragaria vesca subsp. vesca] Length = 344 Score = 60.8 bits (146), Expect = 2e-06 Identities = 28/39 (71%), Positives = 33/39 (84%) Frame = -3 Query: 726 RHRSLIERDVRVRLVYGSPKMDSSFSFVYMNRQLVWNEF 610 R+R+LIER +R RLVYGSP M+ + SF YMNRQLVWNEF Sbjct: 210 RYRTLIERALRARLVYGSPIMNRAVSFEYMNRQLVWNEF 248 >gb|EMJ16856.1| hypothetical protein PRUPE_ppa008363mg [Prunus persica] Length = 335 Score = 60.8 bits (146), Expect = 2e-06 Identities = 27/39 (69%), Positives = 33/39 (84%) Frame = -3 Query: 726 RHRSLIERDVRVRLVYGSPKMDSSFSFVYMNRQLVWNEF 610 R+R+LIER ++ RLVYGSP M+ + SF YMNRQLVWNEF Sbjct: 203 RYRNLIERALKARLVYGSPNMNRAVSFEYMNRQLVWNEF 241