BLASTX nr result
ID: Achyranthes22_contig00005646
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes22_contig00005646 (603 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006359786.1| PREDICTED: root phototropism protein 3-like ... 58 2e-06 ref|XP_004248794.1| PREDICTED: root phototropism protein 3-like ... 57 5e-06 >ref|XP_006359786.1| PREDICTED: root phototropism protein 3-like [Solanum tuberosum] Length = 676 Score = 57.8 bits (138), Expect = 2e-06 Identities = 26/38 (68%), Positives = 33/38 (86%) Frame = +1 Query: 490 MWDSETESLGGRELSGNGALALTKHGLKTDGFEQRGQS 603 MW+SE+ES+ GR+ GNG L+ TKHG+KTDGFEQ+GQS Sbjct: 1 MWESESESVSGRDY-GNGVLSNTKHGVKTDGFEQKGQS 37 >ref|XP_004248794.1| PREDICTED: root phototropism protein 3-like [Solanum lycopersicum] Length = 674 Score = 56.6 bits (135), Expect = 5e-06 Identities = 26/38 (68%), Positives = 32/38 (84%) Frame = +1 Query: 490 MWDSETESLGGRELSGNGALALTKHGLKTDGFEQRGQS 603 MW+SE+ES+ GR+ GNG L TKHG+KTDGFEQ+GQS Sbjct: 1 MWESESESVSGRDY-GNGVLNNTKHGVKTDGFEQKGQS 37