BLASTX nr result
ID: Achyranthes22_contig00005639
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes22_contig00005639 (655 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002515417.1| conserved hypothetical protein [Ricinus comm... 59 2e-06 >ref|XP_002515417.1| conserved hypothetical protein [Ricinus communis] gi|223545361|gb|EEF46866.1| conserved hypothetical protein [Ricinus communis] Length = 143 Score = 58.5 bits (140), Expect = 2e-06 Identities = 33/99 (33%), Positives = 58/99 (58%), Gaps = 1/99 (1%) Frame = -2 Query: 399 ILPKGVSGFSMDSCRSSSIDEMAKTREKHQSLLQDYLVLQKECVSXXXXXXXXXXXKDTL 220 +L + + ++DS +S S+ + + K+Q+LLQDY +LQKE VS +D L Sbjct: 1 MLKRNLKRLAIDSYQSQSV--VNEEARKYQTLLQDYFILQKEFVSIKKNLQTTEQKRDIL 58 Query: 219 LDEIRFLKHRRNLLLKMQSQN-SDQQDTISLQKAHVKYE 106 + E++FL+ R L+ +QS N +QD + LQ + ++Y+ Sbjct: 59 MAEVQFLRQRHRYLMDVQSDNLQPEQDPVPLQDSAMQYK 97