BLASTX nr result
ID: Achyranthes22_contig00005569
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes22_contig00005569 (211 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ABJ99599.1| NBS-LRR type resistance protein [Beta vulgaris] 69 5e-10 >gb|ABJ99599.1| NBS-LRR type resistance protein [Beta vulgaris] Length = 1067 Score = 69.3 bits (168), Expect = 5e-10 Identities = 27/40 (67%), Positives = 32/40 (80%) Frame = -1 Query: 121 LKNMPKWMPKIISLKNLHVWDCSKSLERRCQEDPQGEDWP 2 L+ MP WMPK+ SL L +W CS+SLERRCQ+DP GEDWP Sbjct: 1017 LRAMPNWMPKLTSLDQLEIWPCSESLERRCQKDPPGEDWP 1056