BLASTX nr result
ID: Achyranthes22_contig00004444
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes22_contig00004444 (543 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAC09928.1| hypothetical protein [Catharanthus roseus] 56 5e-06 >emb|CAC09928.1| hypothetical protein [Catharanthus roseus] Length = 196 Score = 56.2 bits (134), Expect = 5e-06 Identities = 29/55 (52%), Positives = 37/55 (67%), Gaps = 2/55 (3%) Frame = -3 Query: 541 LDKEEKIIELGSRNFFLCKRR--REVVEMTASCSKEAENATNIGGAPFSPWLKFI 383 L +EEK+I LGSRNFFLC +R E ++ CSKEA+ AT G +PWLKF+ Sbjct: 142 LHREEKLISLGSRNFFLCPKRCGAEPTASSSGCSKEADKATKTG----TPWLKFM 192