BLASTX nr result
ID: Achyranthes22_contig00004426
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes22_contig00004426 (297 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAP03014.1| NEP1-interacting protein [Spinacia oleracea] 72 8e-11 >emb|CAP03014.1| NEP1-interacting protein [Spinacia oleracea] Length = 235 Score = 72.0 bits (175), Expect = 8e-11 Identities = 38/44 (86%), Positives = 42/44 (95%), Gaps = 1/44 (2%) Frame = -3 Query: 130 MEFYSYPSQQMASSS-VLYNLGEKIRGTLSFAVSVTLGSLFSAF 2 MEFYSYPSQ++ASSS +L +LGEKIRGTLSFAVSVTLGSLFSAF Sbjct: 1 MEFYSYPSQRIASSSSILCDLGEKIRGTLSFAVSVTLGSLFSAF 44