BLASTX nr result
ID: Achyranthes22_contig00004355
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes22_contig00004355 (1959 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004155128.1| PREDICTED: photosystem I reaction center sub... 60 3e-06 >ref|XP_004155128.1| PREDICTED: photosystem I reaction center subunit XI, chloroplastic-like [Cucumis sativus] Length = 177 Score = 60.1 bits (144), Expect = 3e-06 Identities = 27/32 (84%), Positives = 30/32 (93%) Frame = -3 Query: 97 LILLLQPTYQVIQPINGDPFIGGLETPVTSSP 2 ++ LLQPT+QVIQPINGDPFIG LETPVTSSP Sbjct: 9 VLKLLQPTFQVIQPINGDPFIGSLETPVTSSP 40