BLASTX nr result
ID: Achyranthes22_contig00002970
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes22_contig00002970 (438 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EOX93760.1| Lactoylglutathione lyase / glyoxalase I family pr... 55 1e-05 >gb|EOX93760.1| Lactoylglutathione lyase / glyoxalase I family protein [Theobroma cacao] Length = 161 Score = 55.1 bits (131), Expect = 1e-05 Identities = 30/42 (71%), Positives = 32/42 (76%), Gaps = 3/42 (7%) Frame = -1 Query: 438 EGEVTEDEVA---GRVGKVKDPYGYLWAISSPAVKKTADVEA 322 EGEVTE E A GRVGKVKDPYGY+W I +PA KK DVEA Sbjct: 121 EGEVTEGEGACCGGRVGKVKDPYGYVWLICTPA-KKCVDVEA 161