BLASTX nr result
ID: Achyranthes22_contig00001125
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Achyranthes22_contig00001125 (734 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006421267.1| hypothetical protein CICLE_v10006402mg [Citr... 60 6e-07 >ref|XP_006421267.1| hypothetical protein CICLE_v10006402mg [Citrus clementina] gi|557523140|gb|ESR34507.1| hypothetical protein CICLE_v10006402mg [Citrus clementina] Length = 60 Score = 60.5 bits (145), Expect = 6e-07 Identities = 27/48 (56%), Positives = 34/48 (70%) Frame = +3 Query: 207 QQQQNMDNVPPAGYPTLTPPEGKMKKKGWFRTKKRGEKGFIEGCLAGL 350 + + +N PPAGYPT PP GK KKK +TKK+G++GFIEGCL L Sbjct: 3 KSSETENNQPPAGYPTENPPAGKGKKKCLSQTKKKGDRGFIEGCLFAL 50