BLASTX nr result
ID: Acanthopanax24_contig00026455
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Acanthopanax24_contig00026455 (420 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_022865992.1| mitochondrial thiamine diphosphate carrier 2... 158 3e-46 ref|XP_017220695.1| PREDICTED: mitochondrial thiamine pyrophosph... 155 7e-44 ref|XP_022722613.1| mitochondrial thiamine diphosphate carrier 2... 155 1e-43 ref|XP_002272682.1| PREDICTED: mitochondrial thiamine pyrophosph... 155 1e-43 ref|XP_007035559.2| PREDICTED: mitochondrial thiamine pyrophosph... 153 5e-43 ref|XP_020552930.1| mitochondrial thiamine pyrophosphate carrier... 152 7e-43 ref|XP_010259669.1| PREDICTED: mitochondrial thiamine pyrophosph... 151 7e-43 ref|XP_009419905.1| PREDICTED: mitochondrial thiamine pyrophosph... 153 8e-43 ref|XP_022760551.1| mitochondrial thiamine diphosphate carrier 2... 151 9e-43 ref|XP_011090946.1| mitochondrial thiamine pyrophosphate carrier... 152 1e-42 ref|XP_020250653.1| mitochondrial thiamine pyrophosphate carrier... 152 2e-42 ref|XP_020250652.1| mitochondrial thiamine pyrophosphate carrier... 152 2e-42 ref|XP_011090945.1| mitochondrial thiamine pyrophosphate carrier... 152 3e-42 ref|XP_022760550.1| mitochondrial thiamine diphosphate carrier 2... 151 3e-42 ref|XP_010259667.1| PREDICTED: mitochondrial thiamine pyrophosph... 151 3e-42 ref|XP_023763828.1| mitochondrial thiamine diphosphate carrier 2... 151 4e-42 gb|OVA14999.1| Mitochondrial carrier protein [Macleaya cordata] 151 4e-42 gb|EOY06485.1| Mitochondrial substrate carrier family protein [T... 151 4e-42 ref|XP_010269464.1| PREDICTED: mitochondrial thiamine pyrophosph... 151 4e-42 ref|XP_020086127.1| mitochondrial thiamine pyrophosphate carrier... 149 5e-42 >ref|XP_022865992.1| mitochondrial thiamine diphosphate carrier 2-like [Olea europaea var. sylvestris] ref|XP_022865993.1| mitochondrial thiamine diphosphate carrier 2-like [Olea europaea var. sylvestris] ref|XP_022865994.1| mitochondrial thiamine diphosphate carrier 2-like [Olea europaea var. sylvestris] ref|XP_022865995.1| mitochondrial thiamine diphosphate carrier 2-like [Olea europaea var. sylvestris] ref|XP_022865996.1| mitochondrial thiamine diphosphate carrier 2-like [Olea europaea var. sylvestris] ref|XP_022865997.1| mitochondrial thiamine diphosphate carrier 2-like [Olea europaea var. sylvestris] Length = 212 Score = 158 bits (400), Expect = 3e-46 Identities = 77/85 (90%), Positives = 80/85 (94%) Frame = +1 Query: 166 MEEPGQLKRAFIDATTGAVSGAVSRTVTSPLDVIKIRFQVQLEPTSSWALLRKDVYGTSK 345 MEEPGQLKRA IDAT GA+SGA+SRTVTSPLDVIKIRFQVQLEPT+ WALLRKDVYG SK Sbjct: 1 MEEPGQLKRALIDATAGALSGAISRTVTSPLDVIKIRFQVQLEPTTQWALLRKDVYGPSK 60 Query: 346 YTGMLQATKDIFREEGLAGFWRGNV 420 YTGMLQATKDIFREEGL GFWRGNV Sbjct: 61 YTGMLQATKDIFREEGLRGFWRGNV 85 >ref|XP_017220695.1| PREDICTED: mitochondrial thiamine pyrophosphate carrier-like [Daucus carota subsp. sativus] ref|XP_017220696.1| PREDICTED: mitochondrial thiamine pyrophosphate carrier-like [Daucus carota subsp. sativus] Length = 329 Score = 155 bits (393), Expect = 7e-44 Identities = 76/85 (89%), Positives = 81/85 (95%) Frame = +1 Query: 166 MEEPGQLKRAFIDATTGAVSGAVSRTVTSPLDVIKIRFQVQLEPTSSWALLRKDVYGTSK 345 MEEPGQLK+AFI+AT GA SGAVSRTVTSPLDVIKIRFQVQLEPTSSWALLRK ++GTSK Sbjct: 1 MEEPGQLKQAFINATAGAASGAVSRTVTSPLDVIKIRFQVQLEPTSSWALLRKQLHGTSK 60 Query: 346 YTGMLQATKDIFREEGLAGFWRGNV 420 YTGMLQATKDI+REEGL GFWRGNV Sbjct: 61 YTGMLQATKDIYREEGLPGFWRGNV 85 >ref|XP_022722613.1| mitochondrial thiamine diphosphate carrier 2-like [Durio zibethinus] Length = 330 Score = 155 bits (392), Expect = 1e-43 Identities = 74/85 (87%), Positives = 80/85 (94%) Frame = +1 Query: 166 MEEPGQLKRAFIDATTGAVSGAVSRTVTSPLDVIKIRFQVQLEPTSSWALLRKDVYGTSK 345 MEEPGQLKRAF+DAT GA++G +SRTVTSPLDVIKIRFQVQLEPTSSWALLRKD+ G+SK Sbjct: 1 MEEPGQLKRAFLDATAGAIAGGISRTVTSPLDVIKIRFQVQLEPTSSWALLRKDLSGSSK 60 Query: 346 YTGMLQATKDIFREEGLAGFWRGNV 420 YTGM QATKDIFREEGL GFWRGNV Sbjct: 61 YTGMFQATKDIFREEGLPGFWRGNV 85 >ref|XP_002272682.1| PREDICTED: mitochondrial thiamine pyrophosphate carrier [Vitis vinifera] ref|XP_010649727.1| PREDICTED: mitochondrial thiamine pyrophosphate carrier [Vitis vinifera] ref|XP_010649728.1| PREDICTED: mitochondrial thiamine pyrophosphate carrier [Vitis vinifera] ref|XP_010649729.1| PREDICTED: mitochondrial thiamine pyrophosphate carrier [Vitis vinifera] ref|XP_010649730.1| PREDICTED: mitochondrial thiamine pyrophosphate carrier [Vitis vinifera] emb|CBI26066.3| unnamed protein product, partial [Vitis vinifera] Length = 330 Score = 155 bits (392), Expect = 1e-43 Identities = 74/85 (87%), Positives = 80/85 (94%) Frame = +1 Query: 166 MEEPGQLKRAFIDATTGAVSGAVSRTVTSPLDVIKIRFQVQLEPTSSWALLRKDVYGTSK 345 MEEPGQLKRAFIDA GA++G +SRTVTSPLDVIKIRFQVQLEPT+SWALLR+DV+G SK Sbjct: 1 MEEPGQLKRAFIDAAAGAIAGGISRTVTSPLDVIKIRFQVQLEPTTSWALLRRDVHGQSK 60 Query: 346 YTGMLQATKDIFREEGLAGFWRGNV 420 YTGMLQATKDIFREEGL GFWRGNV Sbjct: 61 YTGMLQATKDIFREEGLPGFWRGNV 85 >ref|XP_007035559.2| PREDICTED: mitochondrial thiamine pyrophosphate carrier [Theobroma cacao] Length = 330 Score = 153 bits (387), Expect = 5e-43 Identities = 74/85 (87%), Positives = 79/85 (92%) Frame = +1 Query: 166 MEEPGQLKRAFIDATTGAVSGAVSRTVTSPLDVIKIRFQVQLEPTSSWALLRKDVYGTSK 345 MEEPGQLKRA IDAT GA+SG +SRTVTSPLDVIKIRFQVQLEPTSSWALLR+D+ G+SK Sbjct: 1 MEEPGQLKRALIDATAGAISGGISRTVTSPLDVIKIRFQVQLEPTSSWALLRRDLPGSSK 60 Query: 346 YTGMLQATKDIFREEGLAGFWRGNV 420 YTGM QATKDIFREEGL GFWRGNV Sbjct: 61 YTGMFQATKDIFREEGLPGFWRGNV 85 >ref|XP_020552930.1| mitochondrial thiamine pyrophosphate carrier isoform X3 [Sesamum indicum] Length = 299 Score = 152 bits (384), Expect = 7e-43 Identities = 72/85 (84%), Positives = 79/85 (92%) Frame = +1 Query: 166 MEEPGQLKRAFIDATTGAVSGAVSRTVTSPLDVIKIRFQVQLEPTSSWALLRKDVYGTSK 345 MEEPGQ+KRA IDA+ GA+SGA+SRTVTSPLDVIKIRFQVQLEPT+ WALLR+DVY +K Sbjct: 31 MEEPGQIKRALIDASAGAISGAISRTVTSPLDVIKIRFQVQLEPTTQWALLRRDVYNPAK 90 Query: 346 YTGMLQATKDIFREEGLAGFWRGNV 420 YTGMLQATKDIFREEGL GFWRGNV Sbjct: 91 YTGMLQATKDIFREEGLPGFWRGNV 115 >ref|XP_010259669.1| PREDICTED: mitochondrial thiamine pyrophosphate carrier-like isoform X2 [Nelumbo nucifera] Length = 274 Score = 151 bits (382), Expect = 7e-43 Identities = 71/85 (83%), Positives = 78/85 (91%) Frame = +1 Query: 166 MEEPGQLKRAFIDATTGAVSGAVSRTVTSPLDVIKIRFQVQLEPTSSWALLRKDVYGTSK 345 MEEP QLKRA ID+T G +SG +SRT+TSPLDVIKIRFQVQLEPTSSWALL +D+YGTSK Sbjct: 1 MEEPSQLKRALIDSTAGVISGGISRTITSPLDVIKIRFQVQLEPTSSWALLHRDLYGTSK 60 Query: 346 YTGMLQATKDIFREEGLAGFWRGNV 420 YTG+LQATKDIFREEGL GFWRGNV Sbjct: 61 YTGILQATKDIFREEGLPGFWRGNV 85 >ref|XP_009419905.1| PREDICTED: mitochondrial thiamine pyrophosphate carrier isoform X1 [Musa acuminata subsp. malaccensis] Length = 331 Score = 153 bits (386), Expect = 8e-43 Identities = 71/85 (83%), Positives = 81/85 (95%) Frame = +1 Query: 166 MEEPGQLKRAFIDATTGAVSGAVSRTVTSPLDVIKIRFQVQLEPTSSWALLRKDVYGTSK 345 MEEPGQLKRA +D+ GAVSG +SRTVTSPLDVIKIRFQVQ+EPTSSWALL++D+YGTSK Sbjct: 1 MEEPGQLKRALVDSLAGAVSGGISRTVTSPLDVIKIRFQVQIEPTSSWALLKRDLYGTSK 60 Query: 346 YTGMLQATKDIFREEGLAGFWRGNV 420 YTG+LQAT+DIFREEGL+GFWRGNV Sbjct: 61 YTGILQATRDIFREEGLSGFWRGNV 85 >ref|XP_022760551.1| mitochondrial thiamine diphosphate carrier 2-like isoform X2 [Durio zibethinus] Length = 281 Score = 151 bits (382), Expect = 9e-43 Identities = 73/85 (85%), Positives = 79/85 (92%) Frame = +1 Query: 166 MEEPGQLKRAFIDATTGAVSGAVSRTVTSPLDVIKIRFQVQLEPTSSWALLRKDVYGTSK 345 MEE GQLKRA +DA+ GA+SG +SRTVTSPLDVIKIRFQVQLEPTSSWALLRKD+ G+SK Sbjct: 1 MEESGQLKRALLDASAGAISGGISRTVTSPLDVIKIRFQVQLEPTSSWALLRKDLSGSSK 60 Query: 346 YTGMLQATKDIFREEGLAGFWRGNV 420 YTGM QATKDIFREEGLAGFWRGNV Sbjct: 61 YTGMFQATKDIFREEGLAGFWRGNV 85 >ref|XP_011090946.1| mitochondrial thiamine pyrophosphate carrier isoform X2 [Sesamum indicum] Length = 329 Score = 152 bits (384), Expect = 1e-42 Identities = 72/85 (84%), Positives = 79/85 (92%) Frame = +1 Query: 166 MEEPGQLKRAFIDATTGAVSGAVSRTVTSPLDVIKIRFQVQLEPTSSWALLRKDVYGTSK 345 MEEPGQ+KRA IDA+ GA+SGA+SRTVTSPLDVIKIRFQVQLEPT+ WALLR+DVY +K Sbjct: 1 MEEPGQIKRALIDASAGAISGAISRTVTSPLDVIKIRFQVQLEPTTQWALLRRDVYNPAK 60 Query: 346 YTGMLQATKDIFREEGLAGFWRGNV 420 YTGMLQATKDIFREEGL GFWRGNV Sbjct: 61 YTGMLQATKDIFREEGLPGFWRGNV 85 >ref|XP_020250653.1| mitochondrial thiamine pyrophosphate carrier 1 isoform X2 [Asparagus officinalis] gb|ONK54927.1| uncharacterized protein A4U43_UnF9600 [Asparagus officinalis] Length = 331 Score = 152 bits (384), Expect = 2e-42 Identities = 73/85 (85%), Positives = 79/85 (92%) Frame = +1 Query: 166 MEEPGQLKRAFIDATTGAVSGAVSRTVTSPLDVIKIRFQVQLEPTSSWALLRKDVYGTSK 345 MEEPGQLKRAFIDAT GA+SG +SRTVTSPLDVIKIRFQVQLEPT+SW LL+KD+Y SK Sbjct: 1 MEEPGQLKRAFIDATAGAISGGISRTVTSPLDVIKIRFQVQLEPTTSWPLLQKDLYRPSK 60 Query: 346 YTGMLQATKDIFREEGLAGFWRGNV 420 YTG+LQATKDIFREEGL GFWRGNV Sbjct: 61 YTGILQATKDIFREEGLPGFWRGNV 85 >ref|XP_020250652.1| mitochondrial thiamine pyrophosphate carrier 1 isoform X1 [Asparagus officinalis] Length = 343 Score = 152 bits (384), Expect = 2e-42 Identities = 73/85 (85%), Positives = 79/85 (92%) Frame = +1 Query: 166 MEEPGQLKRAFIDATTGAVSGAVSRTVTSPLDVIKIRFQVQLEPTSSWALLRKDVYGTSK 345 MEEPGQLKRAFIDAT GA+SG +SRTVTSPLDVIKIRFQVQLEPT+SW LL+KD+Y SK Sbjct: 1 MEEPGQLKRAFIDATAGAISGGISRTVTSPLDVIKIRFQVQLEPTTSWPLLQKDLYRPSK 60 Query: 346 YTGMLQATKDIFREEGLAGFWRGNV 420 YTG+LQATKDIFREEGL GFWRGNV Sbjct: 61 YTGILQATKDIFREEGLPGFWRGNV 85 >ref|XP_011090945.1| mitochondrial thiamine pyrophosphate carrier isoform X1 [Sesamum indicum] Length = 359 Score = 152 bits (384), Expect = 3e-42 Identities = 72/85 (84%), Positives = 79/85 (92%) Frame = +1 Query: 166 MEEPGQLKRAFIDATTGAVSGAVSRTVTSPLDVIKIRFQVQLEPTSSWALLRKDVYGTSK 345 MEEPGQ+KRA IDA+ GA+SGA+SRTVTSPLDVIKIRFQVQLEPT+ WALLR+DVY +K Sbjct: 31 MEEPGQIKRALIDASAGAISGAISRTVTSPLDVIKIRFQVQLEPTTQWALLRRDVYNPAK 90 Query: 346 YTGMLQATKDIFREEGLAGFWRGNV 420 YTGMLQATKDIFREEGL GFWRGNV Sbjct: 91 YTGMLQATKDIFREEGLPGFWRGNV 115 >ref|XP_022760550.1| mitochondrial thiamine diphosphate carrier 2-like isoform X1 [Durio zibethinus] Length = 330 Score = 151 bits (382), Expect = 3e-42 Identities = 73/85 (85%), Positives = 79/85 (92%) Frame = +1 Query: 166 MEEPGQLKRAFIDATTGAVSGAVSRTVTSPLDVIKIRFQVQLEPTSSWALLRKDVYGTSK 345 MEE GQLKRA +DA+ GA+SG +SRTVTSPLDVIKIRFQVQLEPTSSWALLRKD+ G+SK Sbjct: 1 MEESGQLKRALLDASAGAISGGISRTVTSPLDVIKIRFQVQLEPTSSWALLRKDLSGSSK 60 Query: 346 YTGMLQATKDIFREEGLAGFWRGNV 420 YTGM QATKDIFREEGLAGFWRGNV Sbjct: 61 YTGMFQATKDIFREEGLAGFWRGNV 85 >ref|XP_010259667.1| PREDICTED: mitochondrial thiamine pyrophosphate carrier 1-like isoform X1 [Nelumbo nucifera] ref|XP_010259668.1| PREDICTED: mitochondrial thiamine pyrophosphate carrier 1-like isoform X1 [Nelumbo nucifera] Length = 331 Score = 151 bits (382), Expect = 3e-42 Identities = 71/85 (83%), Positives = 78/85 (91%) Frame = +1 Query: 166 MEEPGQLKRAFIDATTGAVSGAVSRTVTSPLDVIKIRFQVQLEPTSSWALLRKDVYGTSK 345 MEEP QLKRA ID+T G +SG +SRT+TSPLDVIKIRFQVQLEPTSSWALL +D+YGTSK Sbjct: 1 MEEPSQLKRALIDSTAGVISGGISRTITSPLDVIKIRFQVQLEPTSSWALLHRDLYGTSK 60 Query: 346 YTGMLQATKDIFREEGLAGFWRGNV 420 YTG+LQATKDIFREEGL GFWRGNV Sbjct: 61 YTGILQATKDIFREEGLPGFWRGNV 85 >ref|XP_023763828.1| mitochondrial thiamine diphosphate carrier 2 [Lactuca sativa] gb|PLY85453.1| hypothetical protein LSAT_3X32161 [Lactuca sativa] Length = 329 Score = 151 bits (381), Expect = 4e-42 Identities = 72/85 (84%), Positives = 81/85 (95%) Frame = +1 Query: 166 MEEPGQLKRAFIDATTGAVSGAVSRTVTSPLDVIKIRFQVQLEPTSSWALLRKDVYGTSK 345 MEEPGQLKRAFIDAT G++SGA+SRTVTSPLDVIKIRFQVQLEPT+S+ALL K+VYG SK Sbjct: 1 MEEPGQLKRAFIDATAGSISGAISRTVTSPLDVIKIRFQVQLEPTTSFALLSKNVYGASK 60 Query: 346 YTGMLQATKDIFREEGLAGFWRGNV 420 YTGM+QA+KDIFREEG +GFWRGNV Sbjct: 61 YTGMIQASKDIFREEGFSGFWRGNV 85 >gb|OVA14999.1| Mitochondrial carrier protein [Macleaya cordata] Length = 344 Score = 151 bits (382), Expect = 4e-42 Identities = 72/85 (84%), Positives = 79/85 (92%) Frame = +1 Query: 166 MEEPGQLKRAFIDATTGAVSGAVSRTVTSPLDVIKIRFQVQLEPTSSWALLRKDVYGTSK 345 MEEPG LKRA IDAT GA++G +SRTVTSPLDVIKIRFQVQLEPTSSWAL RK++YG+SK Sbjct: 14 MEEPGPLKRALIDATAGAIAGGISRTVTSPLDVIKIRFQVQLEPTSSWALARKELYGSSK 73 Query: 346 YTGMLQATKDIFREEGLAGFWRGNV 420 YTG+LQATKDIFREEGL GFWRGNV Sbjct: 74 YTGILQATKDIFREEGLRGFWRGNV 98 >gb|EOY06485.1| Mitochondrial substrate carrier family protein [Theobroma cacao] Length = 330 Score = 151 bits (381), Expect = 4e-42 Identities = 73/85 (85%), Positives = 78/85 (91%) Frame = +1 Query: 166 MEEPGQLKRAFIDATTGAVSGAVSRTVTSPLDVIKIRFQVQLEPTSSWALLRKDVYGTSK 345 MEEPGQLKRA IDAT GA+SG +SRTVTSPLDVIKIRFQVQLEPTSSWALLR+D+ G+SK Sbjct: 1 MEEPGQLKRALIDATAGAISGGISRTVTSPLDVIKIRFQVQLEPTSSWALLRRDLPGSSK 60 Query: 346 YTGMLQATKDIFREEGLAGFWRGNV 420 YTGM QATKDI REEGL GFWRGNV Sbjct: 61 YTGMFQATKDILREEGLPGFWRGNV 85 >ref|XP_010269464.1| PREDICTED: mitochondrial thiamine pyrophosphate carrier [Nelumbo nucifera] ref|XP_010269465.1| PREDICTED: mitochondrial thiamine pyrophosphate carrier [Nelumbo nucifera] ref|XP_010269466.1| PREDICTED: mitochondrial thiamine pyrophosphate carrier [Nelumbo nucifera] ref|XP_010269467.1| PREDICTED: mitochondrial thiamine pyrophosphate carrier [Nelumbo nucifera] Length = 331 Score = 151 bits (381), Expect = 4e-42 Identities = 72/85 (84%), Positives = 79/85 (92%) Frame = +1 Query: 166 MEEPGQLKRAFIDATTGAVSGAVSRTVTSPLDVIKIRFQVQLEPTSSWALLRKDVYGTSK 345 MEEP QLKRA IDAT GA+SG +SRT+TSPLDVIKIRFQVQLEPTSSWALLRKD+Y TSK Sbjct: 1 MEEPSQLKRALIDATAGAISGGISRTLTSPLDVIKIRFQVQLEPTSSWALLRKDLYRTSK 60 Query: 346 YTGMLQATKDIFREEGLAGFWRGNV 420 YTG+LQA+KDIFREEG +GFWRGNV Sbjct: 61 YTGILQASKDIFREEGFSGFWRGNV 85 >ref|XP_020086127.1| mitochondrial thiamine pyrophosphate carrier-like isoform X2 [Ananas comosus] Length = 266 Score = 149 bits (376), Expect = 5e-42 Identities = 71/85 (83%), Positives = 80/85 (94%) Frame = +1 Query: 166 MEEPGQLKRAFIDATTGAVSGAVSRTVTSPLDVIKIRFQVQLEPTSSWALLRKDVYGTSK 345 MEEPGQLKRAFID+ GA++G +SRTVTSPLDVIKIRFQVQLEPTSSWALL++D+Y SK Sbjct: 1 MEEPGQLKRAFIDSLAGALAGGISRTVTSPLDVIKIRFQVQLEPTSSWALLQRDMYRPSK 60 Query: 346 YTGMLQATKDIFREEGLAGFWRGNV 420 YTG+LQA+KDIFREEGLAGFWRGNV Sbjct: 61 YTGILQASKDIFREEGLAGFWRGNV 85