BLASTX nr result
ID: Acanthopanax24_contig00026452
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Acanthopanax24_contig00026452 (543 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_015880922.1| PREDICTED: pentatricopeptide repeat-containi... 93 1e-20 gb|OMP04732.1| hypothetical protein COLO4_09342 [Corchorus olito... 97 6e-20 ref|XP_021296396.1| pentatricopeptide repeat-containing protein ... 97 7e-20 ref|XP_017975593.1| PREDICTED: pentatricopeptide repeat-containi... 97 7e-20 gb|EOY04173.1| Mitochondrial editing factor 22 [Theobroma cacao] 97 7e-20 ref|XP_022772064.1| pentatricopeptide repeat-containing protein ... 97 7e-20 gb|PPD69063.1| hypothetical protein GOBAR_DD34053 [Gossypium bar... 96 8e-20 gb|PPS12486.1| hypothetical protein GOBAR_AA08153 [Gossypium bar... 96 9e-20 ref|XP_017636371.1| PREDICTED: pentatricopeptide repeat-containi... 96 9e-20 ref|XP_016723859.1| PREDICTED: pentatricopeptide repeat-containi... 96 9e-20 ref|XP_012436686.1| PREDICTED: pentatricopeptide repeat-containi... 96 9e-20 ref|XP_023901365.1| pentatricopeptide repeat-containing protein ... 96 9e-20 ref|XP_008379591.1| PREDICTED: LOW QUALITY PROTEIN: pentatricope... 96 1e-19 gb|EXC06936.1| hypothetical protein L484_007616 [Morus notabilis] 96 2e-19 ref|XP_024027724.1| pentatricopeptide repeat-containing protein ... 96 2e-19 ref|XP_021905754.1| pentatricopeptide repeat-containing protein ... 95 3e-19 ref|XP_021631421.1| pentatricopeptide repeat-containing protein ... 94 4e-19 dbj|GAV71167.1| PPR domain-containing protein/PPR_2 domain-conta... 94 4e-19 ref|XP_008811403.1| PREDICTED: pentatricopeptide repeat-containi... 94 6e-19 ref|XP_009341449.1| PREDICTED: pentatricopeptide repeat-containi... 94 6e-19 >ref|XP_015880922.1| PREDICTED: pentatricopeptide repeat-containing protein At3g12770-like [Ziziphus jujuba] Length = 155 Score = 92.8 bits (229), Expect = 1e-20 Identities = 40/43 (93%), Positives = 42/43 (97%) Frame = -1 Query: 543 RACVNCHSATKLISKLVNREIVVRDANRFHHFKDGLCSCGDYW 415 RACVNCHSATKLISKLVNREIVVRD+NRFHHFK+G CSCGDYW Sbjct: 113 RACVNCHSATKLISKLVNREIVVRDSNRFHHFKNGSCSCGDYW 155 >gb|OMP04732.1| hypothetical protein COLO4_09342 [Corchorus olitorius] Length = 594 Score = 96.7 bits (239), Expect = 6e-20 Identities = 41/43 (95%), Positives = 43/43 (100%) Frame = -1 Query: 543 RACVNCHSATKLISKLVNREIVVRDANRFHHFKDGLCSCGDYW 415 RAC+NCHSATKLISKLVNREIVVRDANRFHHFKDG+CSCGDYW Sbjct: 552 RACINCHSATKLISKLVNREIVVRDANRFHHFKDGVCSCGDYW 594 >ref|XP_021296396.1| pentatricopeptide repeat-containing protein At3g12770 [Herrania umbratica] Length = 735 Score = 96.7 bits (239), Expect = 7e-20 Identities = 41/43 (95%), Positives = 43/43 (100%) Frame = -1 Query: 543 RACVNCHSATKLISKLVNREIVVRDANRFHHFKDGLCSCGDYW 415 RAC+NCHSATKLISKLVNREIVVRDANRFHHFKDG+CSCGDYW Sbjct: 693 RACINCHSATKLISKLVNREIVVRDANRFHHFKDGVCSCGDYW 735 >ref|XP_017975593.1| PREDICTED: pentatricopeptide repeat-containing protein At3g12770 [Theobroma cacao] Length = 735 Score = 96.7 bits (239), Expect = 7e-20 Identities = 41/43 (95%), Positives = 43/43 (100%) Frame = -1 Query: 543 RACVNCHSATKLISKLVNREIVVRDANRFHHFKDGLCSCGDYW 415 RAC+NCHSATKLISKLVNREIVVRDANRFHHFKDG+CSCGDYW Sbjct: 693 RACINCHSATKLISKLVNREIVVRDANRFHHFKDGVCSCGDYW 735 >gb|EOY04173.1| Mitochondrial editing factor 22 [Theobroma cacao] Length = 735 Score = 96.7 bits (239), Expect = 7e-20 Identities = 41/43 (95%), Positives = 43/43 (100%) Frame = -1 Query: 543 RACVNCHSATKLISKLVNREIVVRDANRFHHFKDGLCSCGDYW 415 RAC+NCHSATKLISKLVNREIVVRDANRFHHFKDG+CSCGDYW Sbjct: 693 RACINCHSATKLISKLVNREIVVRDANRFHHFKDGVCSCGDYW 735 >ref|XP_022772064.1| pentatricopeptide repeat-containing protein At3g12770-like isoform X1 [Durio zibethinus] ref|XP_022772065.1| pentatricopeptide repeat-containing protein At3g12770-like isoform X2 [Durio zibethinus] Length = 736 Score = 96.7 bits (239), Expect = 7e-20 Identities = 41/43 (95%), Positives = 43/43 (100%) Frame = -1 Query: 543 RACVNCHSATKLISKLVNREIVVRDANRFHHFKDGLCSCGDYW 415 RAC+NCHSATKLISKLVNREIVVRDANRFHHFKDG+CSCGDYW Sbjct: 694 RACINCHSATKLISKLVNREIVVRDANRFHHFKDGVCSCGDYW 736 >gb|PPD69063.1| hypothetical protein GOBAR_DD34053 [Gossypium barbadense] Length = 622 Score = 96.3 bits (238), Expect = 8e-20 Identities = 40/43 (93%), Positives = 43/43 (100%) Frame = -1 Query: 543 RACVNCHSATKLISKLVNREIVVRDANRFHHFKDGLCSCGDYW 415 RAC+NCHSATKLISKLVNREI+VRDANRFHHFKDG+CSCGDYW Sbjct: 580 RACINCHSATKLISKLVNREIIVRDANRFHHFKDGVCSCGDYW 622 >gb|PPS12486.1| hypothetical protein GOBAR_AA08153 [Gossypium barbadense] Length = 732 Score = 96.3 bits (238), Expect = 9e-20 Identities = 40/43 (93%), Positives = 43/43 (100%) Frame = -1 Query: 543 RACVNCHSATKLISKLVNREIVVRDANRFHHFKDGLCSCGDYW 415 RAC+NCHSATKLISKLVNREI+VRDANRFHHFKDG+CSCGDYW Sbjct: 690 RACINCHSATKLISKLVNREIIVRDANRFHHFKDGVCSCGDYW 732 >ref|XP_017636371.1| PREDICTED: pentatricopeptide repeat-containing protein At3g12770 [Gossypium arboreum] Length = 732 Score = 96.3 bits (238), Expect = 9e-20 Identities = 40/43 (93%), Positives = 43/43 (100%) Frame = -1 Query: 543 RACVNCHSATKLISKLVNREIVVRDANRFHHFKDGLCSCGDYW 415 RAC+NCHSATKLISKLVNREI+VRDANRFHHFKDG+CSCGDYW Sbjct: 690 RACINCHSATKLISKLVNREIIVRDANRFHHFKDGVCSCGDYW 732 >ref|XP_016723859.1| PREDICTED: pentatricopeptide repeat-containing protein At3g12770 [Gossypium hirsutum] Length = 732 Score = 96.3 bits (238), Expect = 9e-20 Identities = 40/43 (93%), Positives = 43/43 (100%) Frame = -1 Query: 543 RACVNCHSATKLISKLVNREIVVRDANRFHHFKDGLCSCGDYW 415 RAC+NCHSATKLISKLVNREI+VRDANRFHHFKDG+CSCGDYW Sbjct: 690 RACINCHSATKLISKLVNREIIVRDANRFHHFKDGVCSCGDYW 732 >ref|XP_012436686.1| PREDICTED: pentatricopeptide repeat-containing protein At3g12770 [Gossypium raimondii] gb|KJB48180.1| hypothetical protein B456_008G055100 [Gossypium raimondii] Length = 732 Score = 96.3 bits (238), Expect = 9e-20 Identities = 40/43 (93%), Positives = 43/43 (100%) Frame = -1 Query: 543 RACVNCHSATKLISKLVNREIVVRDANRFHHFKDGLCSCGDYW 415 RAC+NCHSATKLISKLVNREI+VRDANRFHHFKDG+CSCGDYW Sbjct: 690 RACINCHSATKLISKLVNREIIVRDANRFHHFKDGVCSCGDYW 732 >ref|XP_023901365.1| pentatricopeptide repeat-containing protein At3g12770 [Quercus suber] Length = 748 Score = 96.3 bits (238), Expect = 9e-20 Identities = 41/43 (95%), Positives = 43/43 (100%) Frame = -1 Query: 543 RACVNCHSATKLISKLVNREIVVRDANRFHHFKDGLCSCGDYW 415 RACVNCHSATK+ISKLVNREIVVRDANRFHHFKDG+CSCGDYW Sbjct: 706 RACVNCHSATKIISKLVNREIVVRDANRFHHFKDGVCSCGDYW 748 >ref|XP_008379591.1| PREDICTED: LOW QUALITY PROTEIN: pentatricopeptide repeat-containing protein At3g12770-like [Malus domestica] Length = 758 Score = 95.9 bits (237), Expect = 1e-19 Identities = 42/47 (89%), Positives = 44/47 (93%) Frame = -1 Query: 543 RACVNCHSATKLISKLVNREIVVRDANRFHHFKDGLCSCGDYW*EGR 403 RACVNCHSATKLISKLVNREIVVRDA RFHHFKDG CSCGDYW +G+ Sbjct: 696 RACVNCHSATKLISKLVNREIVVRDAKRFHHFKDGXCSCGDYWXKGK 742 >gb|EXC06936.1| hypothetical protein L484_007616 [Morus notabilis] Length = 734 Score = 95.5 bits (236), Expect = 2e-19 Identities = 41/43 (95%), Positives = 42/43 (97%) Frame = -1 Query: 543 RACVNCHSATKLISKLVNREIVVRDANRFHHFKDGLCSCGDYW 415 RACVNCHSATKLIS+LVNREIVVRDANRFHHFKDG CSCGDYW Sbjct: 692 RACVNCHSATKLISRLVNREIVVRDANRFHHFKDGFCSCGDYW 734 >ref|XP_024027724.1| pentatricopeptide repeat-containing protein At3g12770 [Morus notabilis] Length = 746 Score = 95.5 bits (236), Expect = 2e-19 Identities = 41/43 (95%), Positives = 42/43 (97%) Frame = -1 Query: 543 RACVNCHSATKLISKLVNREIVVRDANRFHHFKDGLCSCGDYW 415 RACVNCHSATKLIS+LVNREIVVRDANRFHHFKDG CSCGDYW Sbjct: 704 RACVNCHSATKLISRLVNREIVVRDANRFHHFKDGFCSCGDYW 746 >ref|XP_021905754.1| pentatricopeptide repeat-containing protein At3g12770 isoform X1 [Carica papaya] ref|XP_021905755.1| pentatricopeptide repeat-containing protein At3g12770 isoform X2 [Carica papaya] Length = 734 Score = 94.7 bits (234), Expect = 3e-19 Identities = 41/43 (95%), Positives = 42/43 (97%) Frame = -1 Query: 543 RACVNCHSATKLISKLVNREIVVRDANRFHHFKDGLCSCGDYW 415 RACVNCHSATKLISKLVNREIVVRDANRFHHF DG+CSCGDYW Sbjct: 692 RACVNCHSATKLISKLVNREIVVRDANRFHHFTDGVCSCGDYW 734 >ref|XP_021631421.1| pentatricopeptide repeat-containing protein At3g12770 [Manihot esculenta] gb|OAY35184.1| hypothetical protein MANES_12G078800 [Manihot esculenta] Length = 717 Score = 94.4 bits (233), Expect = 4e-19 Identities = 40/43 (93%), Positives = 42/43 (97%) Frame = -1 Query: 543 RACVNCHSATKLISKLVNREIVVRDANRFHHFKDGLCSCGDYW 415 RACVNCH+ATKLISKL+NREIVVRD NRFHHFKDGLCSCGDYW Sbjct: 675 RACVNCHAATKLISKLMNREIVVRDTNRFHHFKDGLCSCGDYW 717 >dbj|GAV71167.1| PPR domain-containing protein/PPR_2 domain-containing protein/PPR_3 domain-containing protein/DYW_deaminase domain-containing protein [Cephalotus follicularis] Length = 731 Score = 94.4 bits (233), Expect = 4e-19 Identities = 40/43 (93%), Positives = 43/43 (100%) Frame = -1 Query: 543 RACVNCHSATKLISKLVNREIVVRDANRFHHFKDGLCSCGDYW 415 RACVNCHSATKLISKLVNREIVVRD+NRFHHFK+G+CSCGDYW Sbjct: 689 RACVNCHSATKLISKLVNREIVVRDSNRFHHFKNGICSCGDYW 731 >ref|XP_008811403.1| PREDICTED: pentatricopeptide repeat-containing protein At3g12770 [Phoenix dactylifera] Length = 729 Score = 94.0 bits (232), Expect = 6e-19 Identities = 41/43 (95%), Positives = 41/43 (95%) Frame = -1 Query: 543 RACVNCHSATKLISKLVNREIVVRDANRFHHFKDGLCSCGDYW 415 RACVNCHSATKLISKLV REIVVRD NRFHHFKDGLCSCGDYW Sbjct: 687 RACVNCHSATKLISKLVGREIVVRDINRFHHFKDGLCSCGDYW 729 >ref|XP_009341449.1| PREDICTED: pentatricopeptide repeat-containing protein At3g12770-like [Pyrus x bretschneideri] Length = 737 Score = 94.0 bits (232), Expect = 6e-19 Identities = 41/43 (95%), Positives = 41/43 (95%) Frame = -1 Query: 543 RACVNCHSATKLISKLVNREIVVRDANRFHHFKDGLCSCGDYW 415 RACVNCHSATKLISKLVNREIVVRDA RFHHFKDG CSCGDYW Sbjct: 695 RACVNCHSATKLISKLVNREIVVRDAKRFHHFKDGCCSCGDYW 737