BLASTX nr result
ID: Acanthopanax24_contig00026250
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Acanthopanax24_contig00026250 (445 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010258096.1| PREDICTED: pentatricopeptide repeat-containi... 71 2e-11 gb|OVA00786.1| Pentatricopeptide repeat [Macleaya cordata] 69 1e-10 ref|XP_011070945.1| pentatricopeptide repeat-containing protein ... 67 3e-10 ref|XP_002274321.2| PREDICTED: pentatricopeptide repeat-containi... 67 5e-10 gb|PIN21950.1| hypothetical protein CDL12_05363 [Handroanthus im... 66 9e-10 ref|XP_011075594.1| pentatricopeptide repeat-containing protein ... 66 1e-09 ref|XP_010259508.1| PREDICTED: pentatricopeptide repeat-containi... 66 1e-09 gb|OVA18898.1| Pentatricopeptide repeat [Macleaya cordata] 66 1e-09 dbj|GAV57437.1| PPR_2 domain-containing protein [Cephalotus foll... 64 4e-09 ref|XP_021658119.1| pentatricopeptide repeat-containing protein ... 64 4e-09 ref|XP_018859838.1| PREDICTED: pentatricopeptide repeat-containi... 64 4e-09 gb|PON79674.1| Tetratricopeptide-like helical domain containing ... 64 4e-09 gb|PIA63046.1| hypothetical protein AQUCO_00200821v1 [Aquilegia ... 64 5e-09 gb|PIN11470.1| hypothetical protein CDL12_15938 [Handroanthus im... 64 5e-09 ref|XP_022891171.1| pentatricopeptide repeat-containing protein ... 64 5e-09 gb|EOY01722.1| Tetratricopeptide repeat-like superfamily protein... 64 7e-09 gb|EOY01721.1| Tetratricopeptide repeat (TPR)-like superfamily p... 64 7e-09 ref|XP_021661244.1| pentatricopeptide repeat-containing protein ... 64 7e-09 ref|XP_022733395.1| pentatricopeptide repeat-containing protein ... 63 1e-08 ref|XP_022733392.1| pentatricopeptide repeat-containing protein ... 63 1e-08 >ref|XP_010258096.1| PREDICTED: pentatricopeptide repeat-containing protein At1g26460, mitochondrial [Nelumbo nucifera] Length = 609 Score = 71.2 bits (173), Expect = 2e-11 Identities = 32/37 (86%), Positives = 35/37 (94%) Frame = +3 Query: 3 DYESDDQVESLAKKFKIRMGTENRRDLLFNLQFGVDY 113 DYESDDQVESLAKKFKIRMGTENRRD+LFNL++ DY Sbjct: 572 DYESDDQVESLAKKFKIRMGTENRRDMLFNLEYSTDY 608 >gb|OVA00786.1| Pentatricopeptide repeat [Macleaya cordata] Length = 616 Score = 68.6 bits (166), Expect = 1e-10 Identities = 31/38 (81%), Positives = 35/38 (92%) Frame = +3 Query: 3 DYESDDQVESLAKKFKIRMGTENRRDLLFNLQFGVDYA 116 DYESDDQVE+LAKKFKIRMGTENRRD+LFNLQ+ +A Sbjct: 579 DYESDDQVEALAKKFKIRMGTENRRDMLFNLQYSTGFA 616 >ref|XP_011070945.1| pentatricopeptide repeat-containing protein At1g26460, mitochondrial-like [Sesamum indicum] Length = 616 Score = 67.4 bits (163), Expect = 3e-10 Identities = 31/38 (81%), Positives = 35/38 (92%) Frame = +3 Query: 3 DYESDDQVESLAKKFKIRMGTENRRDLLFNLQFGVDYA 116 DYESDD+VESLA++FKIRMGTE RRDLLFNLQ+ DYA Sbjct: 579 DYESDDKVESLARQFKIRMGTETRRDLLFNLQYTTDYA 616 >ref|XP_002274321.2| PREDICTED: pentatricopeptide repeat-containing protein At1g26460, mitochondrial [Vitis vinifera] emb|CBI27281.3| unnamed protein product, partial [Vitis vinifera] Length = 616 Score = 67.0 bits (162), Expect = 5e-10 Identities = 30/38 (78%), Positives = 35/38 (92%) Frame = +3 Query: 3 DYESDDQVESLAKKFKIRMGTENRRDLLFNLQFGVDYA 116 DYES+DQVESLA+KFKIRMGTENRRD+LFNL + +YA Sbjct: 579 DYESNDQVESLARKFKIRMGTENRRDMLFNLAYNTEYA 616 >gb|PIN21950.1| hypothetical protein CDL12_05363 [Handroanthus impetiginosus] Length = 614 Score = 66.2 bits (160), Expect = 9e-10 Identities = 31/38 (81%), Positives = 35/38 (92%) Frame = +3 Query: 3 DYESDDQVESLAKKFKIRMGTENRRDLLFNLQFGVDYA 116 DYESDD+VESLA++FKIRMGTE RRDLLFNLQ+ DYA Sbjct: 576 DYESDDKVESLARQFKIRMGTEIRRDLLFNLQYTTDYA 613 >ref|XP_011075594.1| pentatricopeptide repeat-containing protein At1g26460, mitochondrial isoform X1 [Sesamum indicum] ref|XP_011075595.1| pentatricopeptide repeat-containing protein At1g26460, mitochondrial isoform X1 [Sesamum indicum] Length = 609 Score = 65.9 bits (159), Expect = 1e-09 Identities = 30/38 (78%), Positives = 35/38 (92%) Frame = +3 Query: 3 DYESDDQVESLAKKFKIRMGTENRRDLLFNLQFGVDYA 116 DYESDD+VESLA++FKIRMGTE RRDLLFNLQ+ DY+ Sbjct: 572 DYESDDKVESLARQFKIRMGTEVRRDLLFNLQYSTDYS 609 >ref|XP_010259508.1| PREDICTED: pentatricopeptide repeat-containing protein At1g26460, mitochondrial-like [Nelumbo nucifera] Length = 609 Score = 65.9 bits (159), Expect = 1e-09 Identities = 29/37 (78%), Positives = 34/37 (91%) Frame = +3 Query: 3 DYESDDQVESLAKKFKIRMGTENRRDLLFNLQFGVDY 113 DYESDDQVESL++KFKIRMGTENRR +LFNLQ+ +Y Sbjct: 572 DYESDDQVESLSRKFKIRMGTENRRGMLFNLQYSTEY 608 >gb|OVA18898.1| Pentatricopeptide repeat [Macleaya cordata] Length = 615 Score = 65.9 bits (159), Expect = 1e-09 Identities = 29/38 (76%), Positives = 33/38 (86%) Frame = +3 Query: 3 DYESDDQVESLAKKFKIRMGTENRRDLLFNLQFGVDYA 116 DYESDD VE+LAK FKIRMGTENRRD+LFNL + DY+ Sbjct: 578 DYESDDHVETLAKNFKIRMGTENRRDMLFNLNYNTDYS 615 >dbj|GAV57437.1| PPR_2 domain-containing protein [Cephalotus follicularis] Length = 613 Score = 64.3 bits (155), Expect = 4e-09 Identities = 29/38 (76%), Positives = 34/38 (89%) Frame = +3 Query: 3 DYESDDQVESLAKKFKIRMGTENRRDLLFNLQFGVDYA 116 DYESDD VESLAKKFKIRMG E+RR++LFNL++ DYA Sbjct: 576 DYESDDLVESLAKKFKIRMGVESRRNILFNLEYSTDYA 613 >ref|XP_021658119.1| pentatricopeptide repeat-containing protein At1g26460, mitochondrial-like [Hevea brasiliensis] Length = 619 Score = 64.3 bits (155), Expect = 4e-09 Identities = 29/38 (76%), Positives = 34/38 (89%) Frame = +3 Query: 3 DYESDDQVESLAKKFKIRMGTENRRDLLFNLQFGVDYA 116 DY+SD V+SLAKKFKIRMG ENRRD+LFNL++G DYA Sbjct: 582 DYDSDACVDSLAKKFKIRMGLENRRDILFNLEYGTDYA 619 >ref|XP_018859838.1| PREDICTED: pentatricopeptide repeat-containing protein At1g26460, mitochondrial-like isoform X1 [Juglans regia] Length = 625 Score = 64.3 bits (155), Expect = 4e-09 Identities = 27/38 (71%), Positives = 36/38 (94%) Frame = +3 Query: 3 DYESDDQVESLAKKFKIRMGTENRRDLLFNLQFGVDYA 116 DYESDD+V+SLA+KFKIRMGTENRRD+LFNL++ +++ Sbjct: 587 DYESDDRVDSLARKFKIRMGTENRRDMLFNLEYNTNFS 624 >gb|PON79674.1| Tetratricopeptide-like helical domain containing protein [Parasponia andersonii] Length = 636 Score = 64.3 bits (155), Expect = 4e-09 Identities = 27/38 (71%), Positives = 36/38 (94%) Frame = +3 Query: 3 DYESDDQVESLAKKFKIRMGTENRRDLLFNLQFGVDYA 116 DYESDD+V+SLAK +KIRMG+ENRRD+LFNL++G ++A Sbjct: 598 DYESDDRVDSLAKTYKIRMGSENRRDMLFNLEYGTEFA 635 >gb|PIA63046.1| hypothetical protein AQUCO_00200821v1 [Aquilegia coerulea] gb|PIA63047.1| hypothetical protein AQUCO_00200821v1 [Aquilegia coerulea] gb|PIA63048.1| hypothetical protein AQUCO_00200821v1 [Aquilegia coerulea] gb|PIA63049.1| hypothetical protein AQUCO_00200821v1 [Aquilegia coerulea] Length = 609 Score = 63.9 bits (154), Expect = 5e-09 Identities = 27/37 (72%), Positives = 34/37 (91%) Frame = +3 Query: 3 DYESDDQVESLAKKFKIRMGTENRRDLLFNLQFGVDY 113 DYESDD+VE LAKKFKIRMGTENR+ +LFN+++G +Y Sbjct: 572 DYESDDRVEDLAKKFKIRMGTENRKGILFNIEYGANY 608 >gb|PIN11470.1| hypothetical protein CDL12_15938 [Handroanthus impetiginosus] Length = 615 Score = 63.9 bits (154), Expect = 5e-09 Identities = 28/38 (73%), Positives = 35/38 (92%) Frame = +3 Query: 3 DYESDDQVESLAKKFKIRMGTENRRDLLFNLQFGVDYA 116 DYESDD+VESLA++FK+RMGTE RRDLLFNLQ+ D++ Sbjct: 578 DYESDDKVESLARQFKVRMGTEVRRDLLFNLQYSTDFS 615 >ref|XP_022891171.1| pentatricopeptide repeat-containing protein At1g26460, mitochondrial [Olea europaea var. sylvestris] Length = 617 Score = 63.9 bits (154), Expect = 5e-09 Identities = 27/38 (71%), Positives = 35/38 (92%) Frame = +3 Query: 3 DYESDDQVESLAKKFKIRMGTENRRDLLFNLQFGVDYA 116 DYE+DD+V+SLA+ FKIRMGTENRRD+LFNL++ +YA Sbjct: 580 DYEADDRVDSLARDFKIRMGTENRRDMLFNLEYSTEYA 617 >gb|EOY01722.1| Tetratricopeptide repeat-like superfamily protein isoform 2 [Theobroma cacao] Length = 444 Score = 63.5 bits (153), Expect = 7e-09 Identities = 28/38 (73%), Positives = 34/38 (89%) Frame = +3 Query: 3 DYESDDQVESLAKKFKIRMGTENRRDLLFNLQFGVDYA 116 DYESDD+VESLAKKF I+MG+ENRR +LFNL +G +YA Sbjct: 404 DYESDDRVESLAKKFNIQMGSENRRGMLFNLDYGTEYA 441 >gb|EOY01721.1| Tetratricopeptide repeat (TPR)-like superfamily protein isoform 1 [Theobroma cacao] Length = 616 Score = 63.5 bits (153), Expect = 7e-09 Identities = 28/38 (73%), Positives = 34/38 (89%) Frame = +3 Query: 3 DYESDDQVESLAKKFKIRMGTENRRDLLFNLQFGVDYA 116 DYESDD+VESLAKKF I+MG+ENRR +LFNL +G +YA Sbjct: 576 DYESDDRVESLAKKFNIQMGSENRRGMLFNLDYGTEYA 613 >ref|XP_021661244.1| pentatricopeptide repeat-containing protein At1g26460, mitochondrial [Hevea brasiliensis] ref|XP_021661245.1| pentatricopeptide repeat-containing protein At1g26460, mitochondrial [Hevea brasiliensis] Length = 620 Score = 63.5 bits (153), Expect = 7e-09 Identities = 27/38 (71%), Positives = 34/38 (89%) Frame = +3 Query: 3 DYESDDQVESLAKKFKIRMGTENRRDLLFNLQFGVDYA 116 DY++DD++ SLAK+FKIRMGTE RRD+LFNL +G DYA Sbjct: 583 DYDNDDRLHSLAKQFKIRMGTETRRDMLFNLDYGTDYA 620 >ref|XP_022733395.1| pentatricopeptide repeat-containing protein At1g26460, mitochondrial-like isoform X2 [Durio zibethinus] Length = 547 Score = 62.8 bits (151), Expect = 1e-08 Identities = 28/38 (73%), Positives = 33/38 (86%) Frame = +3 Query: 3 DYESDDQVESLAKKFKIRMGTENRRDLLFNLQFGVDYA 116 DYE DDQVESLAKKF IRMG+ENRR +LF+L +G +YA Sbjct: 509 DYECDDQVESLAKKFSIRMGSENRRGILFDLDYGTEYA 546 >ref|XP_022733392.1| pentatricopeptide repeat-containing protein At1g26460, mitochondrial-like isoform X1 [Durio zibethinus] ref|XP_022733394.1| pentatricopeptide repeat-containing protein At1g26460, mitochondrial-like isoform X1 [Durio zibethinus] Length = 616 Score = 62.8 bits (151), Expect = 1e-08 Identities = 28/38 (73%), Positives = 33/38 (86%) Frame = +3 Query: 3 DYESDDQVESLAKKFKIRMGTENRRDLLFNLQFGVDYA 116 DYE DDQVESLAKKF IRMG+ENRR +LF+L +G +YA Sbjct: 578 DYECDDQVESLAKKFSIRMGSENRRGILFDLDYGTEYA 615