BLASTX nr result
ID: Acanthopanax24_contig00026244
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Acanthopanax24_contig00026244 (846 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PPS08355.1| hypothetical protein GOBAR_AA12284 [Gossypium bar... 84 2e-14 >gb|PPS08355.1| hypothetical protein GOBAR_AA12284 [Gossypium barbadense] Length = 555 Score = 84.0 bits (206), Expect = 2e-14 Identities = 50/89 (56%), Positives = 58/89 (65%) Frame = +3 Query: 3 KAVSSVSERKCAFMVYGNSSPLRDRLGHDGYDILLGVLPHYRKRTTGIRRRFLSWKRCLE 182 KAV SVS+RKCAF+VY NSSPLR RLGHD YDILLGVLPHYR T + + + Sbjct: 470 KAVYSVSKRKCAFLVYCNSSPLRGRLGHDVYDILLGVLPHYRDPT--LLLVLGKMPQNFK 527 Query: 183 ISRPSAKKLVPW*DRWMKPILLDSKPNGD 269 + R +V D + ILLDSKPNGD Sbjct: 528 VKREETCSMVGLMDEAI-TILLDSKPNGD 555