BLASTX nr result
ID: Acanthopanax24_contig00025939
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Acanthopanax24_contig00025939 (495 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|GAU19190.1| hypothetical protein TSUD_198720 [Trifolium subt... 74 1e-13 >dbj|GAU19190.1| hypothetical protein TSUD_198720 [Trifolium subterraneum] Length = 170 Score = 74.3 bits (181), Expect = 1e-13 Identities = 36/37 (97%), Positives = 36/37 (97%) Frame = -1 Query: 141 EKGKLPTQVQVPS*NLAVGGISSAIDEAVIGLAWLGW 31 EKGKLPTQVQVPS NLAVGGISSAIDEAVIGLAWLGW Sbjct: 121 EKGKLPTQVQVPSSNLAVGGISSAIDEAVIGLAWLGW 157