BLASTX nr result
ID: Acanthopanax24_contig00025855
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Acanthopanax24_contig00025855 (541 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PLY94327.1| hypothetical protein LSAT_7X96720 [Lactuca sativa] 96 1e-21 gb|KRH55009.1| hypothetical protein GLYMA_06G224900 [Glycine max] 82 1e-19 gb|OIT38470.1| atp synthase subunit alpha, mitochondrial [Nicoti... 83 2e-17 gb|KZM80793.1| hypothetical protein DCAR_031659 [Daucus carota s... 77 6e-15 gb|PHT98231.1| hypothetical protein BC332_32823 [Capsicum chinense] 67 5e-11 gb|PHT81424.1| hypothetical protein T459_14439 [Capsicum annuum]... 67 5e-11 gb|PHT52371.1| Two-component response regulator ARR12 [Capsicum ... 70 1e-10 gb|EEF39093.1| conserved hypothetical protein [Ricinus communis] 64 4e-10 gb|PHT68443.1| Photosystem I chlorophyll a apoprotein A1 [Capsic... 67 1e-09 gb|KZM80792.1| hypothetical protein DCAR_031658 [Daucus carota s... 64 1e-08 gb|PHU15526.1| hypothetical protein BC332_16731 [Capsicum chinense] 55 4e-06 >gb|PLY94327.1| hypothetical protein LSAT_7X96720 [Lactuca sativa] Length = 155 Score = 95.5 bits (236), Expect = 1e-21 Identities = 43/55 (78%), Positives = 46/55 (83%) Frame = -1 Query: 463 VNHSSYSHSMEMFAFGMKMDEQALEPGTDEIREKDGTGHYTGGVRHDRDLRLKYR 299 + +SYSHSM+ FGMKMDEQALEPGTDEIR K GTGHYTGG RHDRDLR KYR Sbjct: 101 LGRASYSHSMDTLTFGMKMDEQALEPGTDEIRGKHGTGHYTGGARHDRDLRFKYR 155 >gb|KRH55009.1| hypothetical protein GLYMA_06G224900 [Glycine max] Length = 125 Score = 82.4 bits (202), Expect(2) = 1e-19 Identities = 42/50 (84%), Positives = 45/50 (90%) Frame = +3 Query: 132 VSKQEGEARKGEARGSPSLGRLCPGSGNLSLASSGRLVLACALLQVVIPP 281 + KQEGEARKG ARGSPSLGRLCPGSGNL SSG+LV+ACALLQVVIPP Sbjct: 24 LGKQEGEARKGGARGSPSLGRLCPGSGNL---SSGQLVVACALLQVVIPP 70 Score = 41.6 bits (96), Expect(2) = 1e-19 Identities = 17/21 (80%), Positives = 19/21 (90%) Frame = +1 Query: 328 VSPPQYSDRFHLFPEFHQFQA 390 +S PQYSDRFH+ PEFHQFQA Sbjct: 86 MSRPQYSDRFHVSPEFHQFQA 106 >gb|OIT38470.1| atp synthase subunit alpha, mitochondrial [Nicotiana attenuata] Length = 100 Score = 83.2 bits (204), Expect = 2e-17 Identities = 38/39 (97%), Positives = 38/39 (97%) Frame = -1 Query: 274 MTTCNKAQANTSRPEEARLRLPDPGHNLPRDGEPLASPF 158 MTTCNKAQANTSRPEEARLRLPDPG NLPRDGEPLASPF Sbjct: 1 MTTCNKAQANTSRPEEARLRLPDPGQNLPRDGEPLASPF 39 >gb|KZM80793.1| hypothetical protein DCAR_031659 [Daucus carota subsp. sativus] Length = 103 Score = 76.6 bits (187), Expect = 6e-15 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -1 Query: 274 MTTCNKAQANTSRPEEARLRLPDPGHNLPRDGEP 173 MTTCNKAQANTSRPEEARLRLPDPGHNLPRDGEP Sbjct: 1 MTTCNKAQANTSRPEEARLRLPDPGHNLPRDGEP 34 >gb|PHT98231.1| hypothetical protein BC332_32823 [Capsicum chinense] Length = 130 Score = 67.0 bits (162), Expect = 5e-11 Identities = 32/36 (88%), Positives = 34/36 (94%) Frame = +3 Query: 159 KGEARGSPSLGRLCPGSGNLSLASSGRLVLACALLQ 266 K ++ GSPSLGRLCPGSGNLSLASSGRLVLACALLQ Sbjct: 15 KSQSSGSPSLGRLCPGSGNLSLASSGRLVLACALLQ 50 >gb|PHT81424.1| hypothetical protein T459_14439 [Capsicum annuum] gb|PHT89489.1| hypothetical protein T459_04602 [Capsicum annuum] Length = 130 Score = 67.0 bits (162), Expect = 5e-11 Identities = 32/36 (88%), Positives = 34/36 (94%) Frame = +3 Query: 159 KGEARGSPSLGRLCPGSGNLSLASSGRLVLACALLQ 266 K ++ GSPSLGRLCPGSGNLSLASSGRLVLACALLQ Sbjct: 15 KSQSSGSPSLGRLCPGSGNLSLASSGRLVLACALLQ 50 >gb|PHT52371.1| Two-component response regulator ARR12 [Capsicum baccatum] Length = 529 Score = 70.1 bits (170), Expect = 1e-10 Identities = 31/37 (83%), Positives = 33/37 (89%) Frame = -1 Query: 412 KMDEQALEPGTDEIREKDGTGHYTGGVRHDRDLRLKY 302 +MDEQALEPGTDEIR K G+GHYTGG RHDRDLR KY Sbjct: 492 RMDEQALEPGTDEIRGKHGSGHYTGGARHDRDLRKKY 528 >gb|EEF39093.1| conserved hypothetical protein [Ricinus communis] Length = 109 Score = 64.3 bits (155), Expect = 4e-10 Identities = 29/34 (85%), Positives = 30/34 (88%) Frame = -1 Query: 415 MKMDEQALEPGTDEIREKDGTGHYTGGVRHDRDL 314 MK+DEQALEPGTDEIR K GTG YTGG RHDRDL Sbjct: 1 MKIDEQALEPGTDEIRGKHGTGQYTGGARHDRDL 34 >gb|PHT68443.1| Photosystem I chlorophyll a apoprotein A1 [Capsicum annuum] Length = 767 Score = 67.0 bits (162), Expect = 1e-09 Identities = 32/36 (88%), Positives = 34/36 (94%) Frame = +3 Query: 159 KGEARGSPSLGRLCPGSGNLSLASSGRLVLACALLQ 266 K ++ GSPSLGRLCPGSGNLSLASSGRLVLACALLQ Sbjct: 15 KSQSSGSPSLGRLCPGSGNLSLASSGRLVLACALLQ 50 >gb|KZM80792.1| hypothetical protein DCAR_031658 [Daucus carota subsp. sativus] Length = 601 Score = 64.3 bits (155), Expect = 1e-08 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = -3 Query: 539 AFGVMNRKPFRKKDIIRKGWLRTIDCKP 456 AFGVMNRKPFRKKDIIRKGWLRTIDCKP Sbjct: 574 AFGVMNRKPFRKKDIIRKGWLRTIDCKP 601 >gb|PHU15526.1| hypothetical protein BC332_16731 [Capsicum chinense] Length = 216 Score = 54.7 bits (130), Expect(2) = 4e-06 Identities = 33/68 (48%), Positives = 37/68 (54%) Frame = -2 Query: 381 LMKFGKKMEPVTILGG*DMTAT*D*STVEKTKGTGE*LPVIKHRLIRADQKKQGLDYQIL 202 LMKF + ME VTILG HR+IR DQKKQGLDYQIL Sbjct: 81 LMKFEENMEAVTILG---------------------------HRIIRDDQKKQGLDYQIL 113 Query: 201 DTIFLEME 178 +TIF+EME Sbjct: 114 ETIFVEME 121 Score = 23.5 bits (49), Expect(2) = 4e-06 Identities = 10/15 (66%), Positives = 11/15 (73%) Frame = -1 Query: 409 MDEQALEPGTDEIRE 365 MDEQALEPG + E Sbjct: 72 MDEQALEPGLMKFEE 86