BLASTX nr result
ID: Acanthopanax24_contig00025853
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Acanthopanax24_contig00025853 (462 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011044572.1| PREDICTED: F-box/LRR-repeat protein At3g2692... 55 9e-06 ref|XP_006377716.1| hypothetical protein POPTR_0011s10510g [Popu... 55 9e-06 >ref|XP_011044572.1| PREDICTED: F-box/LRR-repeat protein At3g26922-like [Populus euphratica] ref|XP_011044574.1| PREDICTED: F-box/LRR-repeat protein At3g26922-like [Populus euphratica] Length = 378 Score = 54.7 bits (130), Expect = 9e-06 Identities = 33/74 (44%), Positives = 46/74 (62%) Frame = +3 Query: 114 IALSLIHMFKKFSNLKVVTISSFDPIRVLSKFPSLLEHLPSPFLNLKSLKLKVYHEDITS 293 + L+LI M +F + K +T+S + I VLSK P+ L PSPF NLK LKLK H+D+T Sbjct: 301 LGLNLIKMLHQFCSAKSLTLS-MNIIEVLSKIPAALNKHPSPFSNLKYLKLKTDHKDVTF 359 Query: 294 TMLDKVISFLLNSS 335 V+++ L SS Sbjct: 360 PA--HVLNYFLRSS 371 >ref|XP_006377716.1| hypothetical protein POPTR_0011s10510g [Populus trichocarpa] ref|XP_006377717.1| hypothetical protein POPTR_0011s10510g [Populus trichocarpa] gb|PNT12741.1| hypothetical protein POPTR_011G104100v3 [Populus trichocarpa] gb|PNT12742.1| hypothetical protein POPTR_011G104100v3 [Populus trichocarpa] Length = 378 Score = 54.7 bits (130), Expect = 9e-06 Identities = 33/74 (44%), Positives = 47/74 (63%) Frame = +3 Query: 114 IALSLIHMFKKFSNLKVVTISSFDPIRVLSKFPSLLEHLPSPFLNLKSLKLKVYHEDITS 293 + L+LI M +F + K +T+S + I VLSK P+ L PSPF NLK LKLK H+D+ Sbjct: 301 LGLNLIKMLHQFCSAKSLTLS-MNIIEVLSKVPAALNKHPSPFSNLKYLKLKTDHKDV-- 357 Query: 294 TMLDKVISFLLNSS 335 T+ V+++ L SS Sbjct: 358 TLPAHVLNYFLRSS 371