BLASTX nr result
ID: Acanthopanax24_contig00025782
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Acanthopanax24_contig00025782 (564 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_017237473.1| PREDICTED: glutamate receptor 3.3-like [Dauc... 77 4e-13 ref|XP_017257898.1| PREDICTED: glutamate receptor 3.3-like isofo... 77 7e-13 ref|XP_017257897.1| PREDICTED: glutamate receptor 3.3-like isofo... 77 7e-13 ref|XP_019244853.1| PREDICTED: glutamate receptor 3.3 [Nicotiana... 76 1e-12 ref|XP_016502595.1| PREDICTED: glutamate receptor 3.3-like [Nico... 76 1e-12 ref|XP_016479927.1| PREDICTED: glutamate receptor 3.3-like [Nico... 76 1e-12 ref|XP_009786331.1| PREDICTED: glutamate receptor 3.3 isoform X1... 76 1e-12 ref|XP_009618635.1| PREDICTED: glutamate receptor 3.3-like isofo... 76 1e-12 gb|PHT51305.1| Glutamate receptor 3.1 [Capsicum baccatum] 74 5e-12 ref|XP_015073486.1| PREDICTED: glutamate receptor 3.3 [Solanum p... 74 5e-12 gb|PHU21095.1| Glutamate receptor 3.1 [Capsicum chinense] 74 5e-12 ref|XP_016568226.1| PREDICTED: glutamate receptor 3.3 [Capsicum ... 74 5e-12 ref|XP_004238633.2| PREDICTED: glutamate receptor 3.3 [Solanum l... 74 5e-12 ref|XP_006342151.1| PREDICTED: glutamate receptor 3.3 [Solanum t... 74 5e-12 ref|XP_010266234.1| PREDICTED: glutamate receptor 3.3-like isofo... 73 1e-11 ref|XP_018860628.1| PREDICTED: glutamate receptor 3.3-like isofo... 73 1e-11 ref|XP_018860627.1| PREDICTED: glutamate receptor 3.3-like isofo... 73 1e-11 ref|XP_010266233.1| PREDICTED: glutamate receptor 3.3-like isofo... 73 1e-11 ref|XP_018860626.1| PREDICTED: glutamate receptor 3.3-like isofo... 73 1e-11 ref|XP_010266230.1| PREDICTED: glutamate receptor 3.3-like isofo... 73 1e-11 >ref|XP_017237473.1| PREDICTED: glutamate receptor 3.3-like [Daucus carota subsp. sativus] gb|KZN01109.1| hypothetical protein DCAR_009863 [Daucus carota subsp. sativus] Length = 927 Score = 77.4 bits (189), Expect = 4e-13 Identities = 37/39 (94%), Positives = 37/39 (94%) Frame = +1 Query: 448 PRDSPLAVDLSTAILTLSENGDLQRIYDKWLKRSTCSLE 564 PRDSPLAVDLSTAILTLSENGDLQRIYDKWL RSTCS E Sbjct: 778 PRDSPLAVDLSTAILTLSENGDLQRIYDKWLSRSTCSSE 816 >ref|XP_017257898.1| PREDICTED: glutamate receptor 3.3-like isoform X2 [Daucus carota subsp. sativus] ref|XP_017257899.1| PREDICTED: glutamate receptor 3.3-like isoform X2 [Daucus carota subsp. sativus] Length = 831 Score = 76.6 bits (187), Expect = 7e-13 Identities = 36/39 (92%), Positives = 37/39 (94%) Frame = +1 Query: 448 PRDSPLAVDLSTAILTLSENGDLQRIYDKWLKRSTCSLE 564 PRDSPLAVDLSTAILTLSENGDLQRIYDKWL RSTC L+ Sbjct: 703 PRDSPLAVDLSTAILTLSENGDLQRIYDKWLSRSTCRLD 741 >ref|XP_017257897.1| PREDICTED: glutamate receptor 3.3-like isoform X1 [Daucus carota subsp. sativus] gb|KZM89649.1| hypothetical protein DCAR_022988 [Daucus carota subsp. sativus] Length = 907 Score = 76.6 bits (187), Expect = 7e-13 Identities = 36/39 (92%), Positives = 37/39 (94%) Frame = +1 Query: 448 PRDSPLAVDLSTAILTLSENGDLQRIYDKWLKRSTCSLE 564 PRDSPLAVDLSTAILTLSENGDLQRIYDKWL RSTC L+ Sbjct: 779 PRDSPLAVDLSTAILTLSENGDLQRIYDKWLSRSTCRLD 817 >ref|XP_019244853.1| PREDICTED: glutamate receptor 3.3 [Nicotiana attenuata] ref|XP_019244854.1| PREDICTED: glutamate receptor 3.3 [Nicotiana attenuata] gb|OIT03926.1| glutamate receptor 3.3 [Nicotiana attenuata] Length = 930 Score = 75.9 bits (185), Expect = 1e-12 Identities = 36/39 (92%), Positives = 37/39 (94%) Frame = +1 Query: 448 PRDSPLAVDLSTAILTLSENGDLQRIYDKWLKRSTCSLE 564 PRDSPLAVDLSTAILTLSENGDLQRI+DKWL RS CSLE Sbjct: 777 PRDSPLAVDLSTAILTLSENGDLQRIHDKWLSRSACSLE 815 >ref|XP_016502595.1| PREDICTED: glutamate receptor 3.3-like [Nicotiana tabacum] ref|XP_016502603.1| PREDICTED: glutamate receptor 3.3-like [Nicotiana tabacum] Length = 930 Score = 75.9 bits (185), Expect = 1e-12 Identities = 36/39 (92%), Positives = 37/39 (94%) Frame = +1 Query: 448 PRDSPLAVDLSTAILTLSENGDLQRIYDKWLKRSTCSLE 564 PRDSPLAVDLSTAILTLSENGDLQRI+DKWL RS CSLE Sbjct: 777 PRDSPLAVDLSTAILTLSENGDLQRIHDKWLSRSACSLE 815 >ref|XP_016479927.1| PREDICTED: glutamate receptor 3.3-like [Nicotiana tabacum] ref|XP_016479928.1| PREDICTED: glutamate receptor 3.3-like [Nicotiana tabacum] Length = 930 Score = 75.9 bits (185), Expect = 1e-12 Identities = 36/39 (92%), Positives = 37/39 (94%) Frame = +1 Query: 448 PRDSPLAVDLSTAILTLSENGDLQRIYDKWLKRSTCSLE 564 PRDSPLAVDLSTAILTLSENGDLQRI+DKWL RS CSLE Sbjct: 777 PRDSPLAVDLSTAILTLSENGDLQRIHDKWLSRSACSLE 815 >ref|XP_009786331.1| PREDICTED: glutamate receptor 3.3 isoform X1 [Nicotiana sylvestris] Length = 930 Score = 75.9 bits (185), Expect = 1e-12 Identities = 36/39 (92%), Positives = 37/39 (94%) Frame = +1 Query: 448 PRDSPLAVDLSTAILTLSENGDLQRIYDKWLKRSTCSLE 564 PRDSPLAVDLSTAILTLSENGDLQRI+DKWL RS CSLE Sbjct: 777 PRDSPLAVDLSTAILTLSENGDLQRIHDKWLSRSACSLE 815 >ref|XP_009618635.1| PREDICTED: glutamate receptor 3.3-like isoform X1 [Nicotiana tomentosiformis] ref|XP_009618636.1| PREDICTED: glutamate receptor 3.3-like isoform X1 [Nicotiana tomentosiformis] Length = 930 Score = 75.9 bits (185), Expect = 1e-12 Identities = 36/39 (92%), Positives = 37/39 (94%) Frame = +1 Query: 448 PRDSPLAVDLSTAILTLSENGDLQRIYDKWLKRSTCSLE 564 PRDSPLAVDLSTAILTLSENGDLQRI+DKWL RS CSLE Sbjct: 777 PRDSPLAVDLSTAILTLSENGDLQRIHDKWLSRSACSLE 815 >gb|PHT51305.1| Glutamate receptor 3.1 [Capsicum baccatum] Length = 930 Score = 74.3 bits (181), Expect = 5e-12 Identities = 35/39 (89%), Positives = 37/39 (94%) Frame = +1 Query: 448 PRDSPLAVDLSTAILTLSENGDLQRIYDKWLKRSTCSLE 564 PRDSPLAVDLSTAILTLSENGDLQRI+DKWL RS CSL+ Sbjct: 777 PRDSPLAVDLSTAILTLSENGDLQRIHDKWLARSACSLD 815 >ref|XP_015073486.1| PREDICTED: glutamate receptor 3.3 [Solanum pennellii] ref|XP_015073487.1| PREDICTED: glutamate receptor 3.3 [Solanum pennellii] ref|XP_015073488.1| PREDICTED: glutamate receptor 3.3 [Solanum pennellii] ref|XP_015073489.1| PREDICTED: glutamate receptor 3.3 [Solanum pennellii] ref|XP_015073490.1| PREDICTED: glutamate receptor 3.3 [Solanum pennellii] Length = 943 Score = 74.3 bits (181), Expect = 5e-12 Identities = 35/39 (89%), Positives = 37/39 (94%) Frame = +1 Query: 448 PRDSPLAVDLSTAILTLSENGDLQRIYDKWLKRSTCSLE 564 PRDSPLAVDLSTAILTLSENGDLQRI+DKWL RS CSL+ Sbjct: 792 PRDSPLAVDLSTAILTLSENGDLQRIHDKWLARSACSLD 830 >gb|PHU21095.1| Glutamate receptor 3.1 [Capsicum chinense] Length = 945 Score = 74.3 bits (181), Expect = 5e-12 Identities = 35/39 (89%), Positives = 37/39 (94%) Frame = +1 Query: 448 PRDSPLAVDLSTAILTLSENGDLQRIYDKWLKRSTCSLE 564 PRDSPLAVDLSTAILTLSENGDLQRI+DKWL RS CSL+ Sbjct: 792 PRDSPLAVDLSTAILTLSENGDLQRIHDKWLARSACSLD 830 >ref|XP_016568226.1| PREDICTED: glutamate receptor 3.3 [Capsicum annuum] ref|XP_016568227.1| PREDICTED: glutamate receptor 3.3 [Capsicum annuum] gb|PHT85061.1| Glutamate receptor 3.1 [Capsicum annuum] Length = 945 Score = 74.3 bits (181), Expect = 5e-12 Identities = 35/39 (89%), Positives = 37/39 (94%) Frame = +1 Query: 448 PRDSPLAVDLSTAILTLSENGDLQRIYDKWLKRSTCSLE 564 PRDSPLAVDLSTAILTLSENGDLQRI+DKWL RS CSL+ Sbjct: 792 PRDSPLAVDLSTAILTLSENGDLQRIHDKWLARSACSLD 830 >ref|XP_004238633.2| PREDICTED: glutamate receptor 3.3 [Solanum lycopersicum] ref|XP_010320472.1| PREDICTED: glutamate receptor 3.3 [Solanum lycopersicum] ref|XP_010320473.1| PREDICTED: glutamate receptor 3.3 [Solanum lycopersicum] ref|XP_010320474.1| PREDICTED: glutamate receptor 3.3 [Solanum lycopersicum] ref|XP_010320475.1| PREDICTED: glutamate receptor 3.3 [Solanum lycopersicum] Length = 945 Score = 74.3 bits (181), Expect = 5e-12 Identities = 35/39 (89%), Positives = 37/39 (94%) Frame = +1 Query: 448 PRDSPLAVDLSTAILTLSENGDLQRIYDKWLKRSTCSLE 564 PRDSPLAVDLSTAILTLSENGDLQRI+DKWL RS CSL+ Sbjct: 794 PRDSPLAVDLSTAILTLSENGDLQRIHDKWLARSACSLD 832 >ref|XP_006342151.1| PREDICTED: glutamate receptor 3.3 [Solanum tuberosum] ref|XP_006342152.1| PREDICTED: glutamate receptor 3.3 [Solanum tuberosum] Length = 946 Score = 74.3 bits (181), Expect = 5e-12 Identities = 35/39 (89%), Positives = 37/39 (94%) Frame = +1 Query: 448 PRDSPLAVDLSTAILTLSENGDLQRIYDKWLKRSTCSLE 564 PRDSPLAVDLSTAILTLSENGDLQRI+DKWL RS CSL+ Sbjct: 792 PRDSPLAVDLSTAILTLSENGDLQRIHDKWLARSACSLD 830 >ref|XP_010266234.1| PREDICTED: glutamate receptor 3.3-like isoform X3 [Nelumbo nucifera] Length = 928 Score = 73.2 bits (178), Expect = 1e-11 Identities = 33/39 (84%), Positives = 37/39 (94%) Frame = +1 Query: 448 PRDSPLAVDLSTAILTLSENGDLQRIYDKWLKRSTCSLE 564 PRDSP+AVD+STAIL LSENGDLQRI+DKWLKRS CSL+ Sbjct: 783 PRDSPIAVDMSTAILALSENGDLQRIHDKWLKRSACSLD 821 >ref|XP_018860628.1| PREDICTED: glutamate receptor 3.3-like isoform X3 [Juglans regia] Length = 930 Score = 73.2 bits (178), Expect = 1e-11 Identities = 34/39 (87%), Positives = 37/39 (94%) Frame = +1 Query: 448 PRDSPLAVDLSTAILTLSENGDLQRIYDKWLKRSTCSLE 564 PRDSPLA+D+STAIL LSENGDLQRI+DKWL RSTCSLE Sbjct: 777 PRDSPLAIDMSTAILQLSENGDLQRIHDKWLIRSTCSLE 815 >ref|XP_018860627.1| PREDICTED: glutamate receptor 3.3-like isoform X2 [Juglans regia] Length = 943 Score = 73.2 bits (178), Expect = 1e-11 Identities = 34/39 (87%), Positives = 37/39 (94%) Frame = +1 Query: 448 PRDSPLAVDLSTAILTLSENGDLQRIYDKWLKRSTCSLE 564 PRDSPLA+D+STAIL LSENGDLQRI+DKWL RSTCSLE Sbjct: 773 PRDSPLAIDMSTAILQLSENGDLQRIHDKWLIRSTCSLE 811 >ref|XP_010266233.1| PREDICTED: glutamate receptor 3.3-like isoform X2 [Nelumbo nucifera] Length = 944 Score = 73.2 bits (178), Expect = 1e-11 Identities = 33/39 (84%), Positives = 37/39 (94%) Frame = +1 Query: 448 PRDSPLAVDLSTAILTLSENGDLQRIYDKWLKRSTCSLE 564 PRDSP+AVD+STAIL LSENGDLQRI+DKWLKRS CSL+ Sbjct: 799 PRDSPIAVDMSTAILALSENGDLQRIHDKWLKRSACSLD 837 >ref|XP_018860626.1| PREDICTED: glutamate receptor 3.3-like isoform X1 [Juglans regia] Length = 947 Score = 73.2 bits (178), Expect = 1e-11 Identities = 34/39 (87%), Positives = 37/39 (94%) Frame = +1 Query: 448 PRDSPLAVDLSTAILTLSENGDLQRIYDKWLKRSTCSLE 564 PRDSPLA+D+STAIL LSENGDLQRI+DKWL RSTCSLE Sbjct: 777 PRDSPLAIDMSTAILQLSENGDLQRIHDKWLIRSTCSLE 815 >ref|XP_010266230.1| PREDICTED: glutamate receptor 3.3-like isoform X1 [Nelumbo nucifera] ref|XP_010266231.1| PREDICTED: glutamate receptor 3.3-like isoform X1 [Nelumbo nucifera] ref|XP_019054358.1| PREDICTED: glutamate receptor 3.3-like isoform X1 [Nelumbo nucifera] Length = 947 Score = 73.2 bits (178), Expect = 1e-11 Identities = 33/39 (84%), Positives = 37/39 (94%) Frame = +1 Query: 448 PRDSPLAVDLSTAILTLSENGDLQRIYDKWLKRSTCSLE 564 PRDSP+AVD+STAIL LSENGDLQRI+DKWLKRS CSL+ Sbjct: 802 PRDSPIAVDMSTAILALSENGDLQRIHDKWLKRSACSLD 840