BLASTX nr result
ID: Acanthopanax24_contig00025505
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Acanthopanax24_contig00025505 (535 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_017256245.1| PREDICTED: cyclin-dependent kinase inhibitor... 57 1e-06 >ref|XP_017256245.1| PREDICTED: cyclin-dependent kinase inhibitor 7-like [Daucus carota subsp. sativus] gb|KZM90600.1| hypothetical protein DCAR_022035 [Daucus carota subsp. sativus] Length = 172 Score = 56.6 bits (135), Expect = 1e-06 Identities = 38/82 (46%), Positives = 53/82 (64%), Gaps = 6/82 (7%) Frame = -2 Query: 534 AHARAMEVTSSGS--TKRRKLDCGDQLIQSSPPSAAQISNQCRCVMNSPKDSAS----AA 373 AHARA EV S+ + TKRRKLD G+ L+QSS S +S +C C++NSP++S S +A Sbjct: 4 AHARAAEVKSAANSTTKRRKLDAGE-LVQSSSSSFDNLS-KCSCLINSPENSKSPVRNSA 61 Query: 372 PPDQIPASLCFSNDSVKDRSRS 307 DQ PA + S++ + SRS Sbjct: 62 SSDQSPADMPCSHELCDNSSRS 83