BLASTX nr result
ID: Acanthopanax24_contig00025081
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Acanthopanax24_contig00025081 (538 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PNX88324.1| LRR receptor-like kinase resistance protein, part... 86 2e-18 dbj|GAU47950.1| hypothetical protein TSUD_06840 [Trifolium subte... 86 2e-18 ref|XP_018855054.1| PREDICTED: LRR receptor-like serine/threonin... 83 1e-16 gb|KVI11882.1| hypothetical protein Ccrd_009696 [Cynara carduncu... 81 2e-16 ref|XP_019459002.1| PREDICTED: LRR receptor-like serine/threonin... 84 2e-16 ref|XP_013465880.1| LRR receptor-like kinase family protein [Med... 86 3e-16 ref|XP_007161049.1| hypothetical protein PHAVU_001G038400g [Phas... 86 3e-16 ref|XP_004498861.1| PREDICTED: LRR receptor-like serine/threonin... 86 3e-16 gb|AIR08789.1| receptor-like kinase ERECTA [Medicago sativa] 86 3e-16 ref|XP_020234273.1| LRR receptor-like serine/threonine-protein k... 86 3e-16 ref|XP_014504775.1| LRR receptor-like serine/threonine-protein k... 86 3e-16 ref|XP_017430815.1| PREDICTED: LRR receptor-like serine/threonin... 86 3e-16 ref|XP_004498860.1| PREDICTED: LRR receptor-like serine/threonin... 86 3e-16 ref|XP_004498859.1| PREDICTED: LRR receptor-like serine/threonin... 86 3e-16 ref|XP_003588942.2| LRR receptor-like kinase family protein [Med... 86 3e-16 emb|CDP13474.1| unnamed protein product [Coffea canephora] 85 7e-16 ref|NP_001235257.1| ERECTA [Glycine max] >gi|223452456|gb|ACM895... 85 7e-16 gb|KRH05415.1| hypothetical protein GLYMA_17G226100 [Glycine max] 85 9e-16 gb|KHN37058.1| LRR receptor-like serine/threonine-protein kinase... 85 9e-16 ref|XP_003544548.1| PREDICTED: LRR receptor-like serine/threonin... 85 9e-16 >gb|PNX88324.1| LRR receptor-like kinase resistance protein, partial [Trifolium pratense] Length = 123 Score = 86.3 bits (212), Expect = 2e-18 Identities = 40/41 (97%), Positives = 40/41 (97%) Frame = -1 Query: 538 PCYMDEYANLKTPHLVNCSSMSTSDAQLFLKFGEVISQNSE 416 PCYMDEYANLKTPHLVNC SMSTSDAQLFLKFGEVISQNSE Sbjct: 83 PCYMDEYANLKTPHLVNCPSMSTSDAQLFLKFGEVISQNSE 123 >dbj|GAU47950.1| hypothetical protein TSUD_06840 [Trifolium subterraneum] Length = 124 Score = 86.3 bits (212), Expect = 2e-18 Identities = 40/41 (97%), Positives = 40/41 (97%) Frame = -1 Query: 538 PCYMDEYANLKTPHLVNCSSMSTSDAQLFLKFGEVISQNSE 416 PCYMDEYANLKTPHLVNC SMSTSDAQLFLKFGEVISQNSE Sbjct: 84 PCYMDEYANLKTPHLVNCPSMSTSDAQLFLKFGEVISQNSE 124 >ref|XP_018855054.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase ERECTA [Juglans regia] Length = 174 Score = 83.2 bits (204), Expect = 1e-16 Identities = 37/41 (90%), Positives = 40/41 (97%) Frame = -1 Query: 538 PCYMDEYANLKTPHLVNCSSMSTSDAQLFLKFGEVISQNSE 416 PCYMDEYANLKTPH++NC SMSTSDAQLF+KFGEVISQNSE Sbjct: 134 PCYMDEYANLKTPHMLNCPSMSTSDAQLFVKFGEVISQNSE 174 >gb|KVI11882.1| hypothetical protein Ccrd_009696 [Cynara cardunculus var. scolymus] Length = 111 Score = 80.9 bits (198), Expect = 2e-16 Identities = 38/39 (97%), Positives = 39/39 (100%) Frame = -1 Query: 532 YMDEYANLKTPHLVNCSSMSTSDAQLFLKFGEVISQNSE 416 YMDEYANLKTPHLVNCSSMSTSDAQLFLKFGEVISQNS+ Sbjct: 73 YMDEYANLKTPHLVNCSSMSTSDAQLFLKFGEVISQNSD 111 >ref|XP_019459002.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase ERECTA [Lupinus angustifolius] Length = 257 Score = 84.0 bits (206), Expect = 2e-16 Identities = 39/41 (95%), Positives = 39/41 (95%) Frame = -1 Query: 538 PCYMDEYANLKTPHLVNCSSMSTSDAQLFLKFGEVISQNSE 416 PCY DEYANLKTPHLVNC SMSTSDAQLFLKFGEVISQNSE Sbjct: 217 PCYKDEYANLKTPHLVNCPSMSTSDAQLFLKFGEVISQNSE 257 >ref|XP_013465880.1| LRR receptor-like kinase family protein [Medicago truncatula] gb|KEH39916.1| LRR receptor-like kinase family protein [Medicago truncatula] Length = 956 Score = 86.3 bits (212), Expect = 3e-16 Identities = 40/41 (97%), Positives = 40/41 (97%) Frame = -1 Query: 538 PCYMDEYANLKTPHLVNCSSMSTSDAQLFLKFGEVISQNSE 416 PCYMDEYANLKTPHLVNC SMSTSDAQLFLKFGEVISQNSE Sbjct: 916 PCYMDEYANLKTPHLVNCPSMSTSDAQLFLKFGEVISQNSE 956 >ref|XP_007161049.1| hypothetical protein PHAVU_001G038400g [Phaseolus vulgaris] gb|ESW33043.1| hypothetical protein PHAVU_001G038400g [Phaseolus vulgaris] Length = 958 Score = 86.3 bits (212), Expect = 3e-16 Identities = 40/41 (97%), Positives = 40/41 (97%) Frame = -1 Query: 538 PCYMDEYANLKTPHLVNCSSMSTSDAQLFLKFGEVISQNSE 416 PCYMDEYANLKTPHLVNC SMSTSDAQLFLKFGEVISQNSE Sbjct: 918 PCYMDEYANLKTPHLVNCPSMSTSDAQLFLKFGEVISQNSE 958 >ref|XP_004498861.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase ERECTA isoform X3 [Cicer arietinum] Length = 959 Score = 86.3 bits (212), Expect = 3e-16 Identities = 40/41 (97%), Positives = 40/41 (97%) Frame = -1 Query: 538 PCYMDEYANLKTPHLVNCSSMSTSDAQLFLKFGEVISQNSE 416 PCYMDEYANLKTPHLVNC SMSTSDAQLFLKFGEVISQNSE Sbjct: 919 PCYMDEYANLKTPHLVNCPSMSTSDAQLFLKFGEVISQNSE 959 >gb|AIR08789.1| receptor-like kinase ERECTA [Medicago sativa] Length = 978 Score = 86.3 bits (212), Expect = 3e-16 Identities = 40/41 (97%), Positives = 40/41 (97%) Frame = -1 Query: 538 PCYMDEYANLKTPHLVNCSSMSTSDAQLFLKFGEVISQNSE 416 PCYMDEYANLKTPHLVNC SMSTSDAQLFLKFGEVISQNSE Sbjct: 938 PCYMDEYANLKTPHLVNCPSMSTSDAQLFLKFGEVISQNSE 978 >ref|XP_020234273.1| LRR receptor-like serine/threonine-protein kinase ERECTA [Cajanus cajan] gb|KYP72461.1| LRR receptor-like serine/threonine-protein kinase ERL1 [Cajanus cajan] Length = 979 Score = 86.3 bits (212), Expect = 3e-16 Identities = 40/41 (97%), Positives = 40/41 (97%) Frame = -1 Query: 538 PCYMDEYANLKTPHLVNCSSMSTSDAQLFLKFGEVISQNSE 416 PCYMDEYANLKTPHLVNC SMSTSDAQLFLKFGEVISQNSE Sbjct: 939 PCYMDEYANLKTPHLVNCPSMSTSDAQLFLKFGEVISQNSE 979 >ref|XP_014504775.1| LRR receptor-like serine/threonine-protein kinase ERECTA [Vigna radiata var. radiata] Length = 979 Score = 86.3 bits (212), Expect = 3e-16 Identities = 40/41 (97%), Positives = 40/41 (97%) Frame = -1 Query: 538 PCYMDEYANLKTPHLVNCSSMSTSDAQLFLKFGEVISQNSE 416 PCYMDEYANLKTPHLVNC SMSTSDAQLFLKFGEVISQNSE Sbjct: 939 PCYMDEYANLKTPHLVNCPSMSTSDAQLFLKFGEVISQNSE 979 >ref|XP_017430815.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase ERECTA [Vigna angularis] gb|KOM48842.1| hypothetical protein LR48_Vigan07g254600 [Vigna angularis] dbj|BAT82483.1| hypothetical protein VIGAN_03251000 [Vigna angularis var. angularis] Length = 979 Score = 86.3 bits (212), Expect = 3e-16 Identities = 40/41 (97%), Positives = 40/41 (97%) Frame = -1 Query: 538 PCYMDEYANLKTPHLVNCSSMSTSDAQLFLKFGEVISQNSE 416 PCYMDEYANLKTPHLVNC SMSTSDAQLFLKFGEVISQNSE Sbjct: 939 PCYMDEYANLKTPHLVNCPSMSTSDAQLFLKFGEVISQNSE 979 >ref|XP_004498860.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase ERECTA isoform X2 [Cicer arietinum] Length = 980 Score = 86.3 bits (212), Expect = 3e-16 Identities = 40/41 (97%), Positives = 40/41 (97%) Frame = -1 Query: 538 PCYMDEYANLKTPHLVNCSSMSTSDAQLFLKFGEVISQNSE 416 PCYMDEYANLKTPHLVNC SMSTSDAQLFLKFGEVISQNSE Sbjct: 940 PCYMDEYANLKTPHLVNCPSMSTSDAQLFLKFGEVISQNSE 980 >ref|XP_004498859.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase ERECTA isoform X1 [Cicer arietinum] Length = 984 Score = 86.3 bits (212), Expect = 3e-16 Identities = 40/41 (97%), Positives = 40/41 (97%) Frame = -1 Query: 538 PCYMDEYANLKTPHLVNCSSMSTSDAQLFLKFGEVISQNSE 416 PCYMDEYANLKTPHLVNC SMSTSDAQLFLKFGEVISQNSE Sbjct: 944 PCYMDEYANLKTPHLVNCPSMSTSDAQLFLKFGEVISQNSE 984 >ref|XP_003588942.2| LRR receptor-like kinase family protein [Medicago truncatula] gb|AES59193.2| LRR receptor-like kinase family protein [Medicago truncatula] Length = 985 Score = 86.3 bits (212), Expect = 3e-16 Identities = 40/41 (97%), Positives = 40/41 (97%) Frame = -1 Query: 538 PCYMDEYANLKTPHLVNCSSMSTSDAQLFLKFGEVISQNSE 416 PCYMDEYANLKTPHLVNC SMSTSDAQLFLKFGEVISQNSE Sbjct: 945 PCYMDEYANLKTPHLVNCPSMSTSDAQLFLKFGEVISQNSE 985 >emb|CDP13474.1| unnamed protein product [Coffea canephora] Length = 992 Score = 85.1 bits (209), Expect = 7e-16 Identities = 40/41 (97%), Positives = 40/41 (97%) Frame = -1 Query: 538 PCYMDEYANLKTPHLVNCSSMSTSDAQLFLKFGEVISQNSE 416 PCYMDEYANLKTP LVNCSSMSTSDAQLFLKFGEVISQNSE Sbjct: 950 PCYMDEYANLKTPQLVNCSSMSTSDAQLFLKFGEVISQNSE 990 >ref|NP_001235257.1| ERECTA [Glycine max] gb|ACM89555.1| ERECTA [Glycine max] Length = 467 Score = 84.7 bits (208), Expect = 7e-16 Identities = 39/41 (95%), Positives = 40/41 (97%) Frame = -1 Query: 538 PCYMDEYANLKTPHLVNCSSMSTSDAQLFLKFGEVISQNSE 416 PCY+DEYANLKTPHLVNC SMSTSDAQLFLKFGEVISQNSE Sbjct: 427 PCYVDEYANLKTPHLVNCPSMSTSDAQLFLKFGEVISQNSE 467 >gb|KRH05415.1| hypothetical protein GLYMA_17G226100 [Glycine max] Length = 963 Score = 84.7 bits (208), Expect = 9e-16 Identities = 39/41 (95%), Positives = 40/41 (97%) Frame = -1 Query: 538 PCYMDEYANLKTPHLVNCSSMSTSDAQLFLKFGEVISQNSE 416 PCY+DEYANLKTPHLVNC SMSTSDAQLFLKFGEVISQNSE Sbjct: 923 PCYVDEYANLKTPHLVNCPSMSTSDAQLFLKFGEVISQNSE 963 >gb|KHN37058.1| LRR receptor-like serine/threonine-protein kinase ERECTA [Glycine soja] gb|KRH05414.1| hypothetical protein GLYMA_17G226100 [Glycine max] Length = 980 Score = 84.7 bits (208), Expect = 9e-16 Identities = 39/41 (95%), Positives = 40/41 (97%) Frame = -1 Query: 538 PCYMDEYANLKTPHLVNCSSMSTSDAQLFLKFGEVISQNSE 416 PCY+DEYANLKTPHLVNC SMSTSDAQLFLKFGEVISQNSE Sbjct: 940 PCYVDEYANLKTPHLVNCPSMSTSDAQLFLKFGEVISQNSE 980 >ref|XP_003544548.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase ERECTA [Glycine max] gb|KHN17259.1| LRR receptor-like serine/threonine-protein kinase ERECTA [Glycine soja] gb|KRH15603.1| hypothetical protein GLYMA_14G098600 [Glycine max] Length = 980 Score = 84.7 bits (208), Expect = 9e-16 Identities = 39/41 (95%), Positives = 40/41 (97%) Frame = -1 Query: 538 PCYMDEYANLKTPHLVNCSSMSTSDAQLFLKFGEVISQNSE 416 PCY+DEYANLKTPHLVNC SMSTSDAQLFLKFGEVISQNSE Sbjct: 940 PCYVDEYANLKTPHLVNCPSMSTSDAQLFLKFGEVISQNSE 980