BLASTX nr result
ID: Acanthopanax24_contig00024991
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Acanthopanax24_contig00024991 (536 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_017236345.1| PREDICTED: NAC domain-containing protein 78 ... 104 4e-23 ref|XP_017236344.1| PREDICTED: NAC domain-containing protein 78 ... 104 4e-23 ref|XP_022856339.1| NAC domain containing protein 50-like [Olea ... 102 2e-22 ref|XP_022006100.1| NAC domain-containing protein 78-like [Helia... 102 3e-22 ref|XP_022859886.1| NAC domain containing protein 50-like [Olea ... 101 5e-22 ref|XP_023762705.1| NAC domain containing protein 52-like [Lactu... 101 5e-22 ref|XP_017252139.1| PREDICTED: NAC domain-containing protein 78 ... 101 5e-22 ref|XP_017252138.1| PREDICTED: NAC domain-containing protein 78 ... 101 5e-22 ref|XP_019198774.1| PREDICTED: NAC domain-containing protein 78-... 101 5e-22 gb|KZM95834.1| hypothetical protein DCAR_019076 [Daucus carota s... 101 5e-22 gb|AFP93563.1| NAC [Cestrum nocturnum] 101 6e-22 gb|EPS65704.1| nam-like protein 4, partial [Genlisea aurea] 98 7e-22 ref|XP_021976900.1| NAC domain-containing protein 78-like [Helia... 100 1e-21 ref|XP_022841474.1| NAC domain containing protein 50-like isofor... 100 1e-21 ref|XP_022841473.1| NAC domain containing protein 50-like isofor... 100 1e-21 gb|PIN24472.1| hypothetical protein CDL12_02823 [Handroanthus im... 100 1e-21 ref|XP_011076898.1| NAC domain-containing protein 78-like [Sesam... 100 1e-21 ref|XP_019232053.1| PREDICTED: NAC domain-containing protein 78-... 100 1e-21 ref|XP_009625487.1| PREDICTED: NAC domain-containing protein 78-... 100 1e-21 ref|XP_009796718.1| PREDICTED: NAC domain-containing protein 78-... 100 1e-21 >ref|XP_017236345.1| PREDICTED: NAC domain-containing protein 78 isoform X2 [Daucus carota subsp. sativus] Length = 402 Score = 104 bits (259), Expect = 4e-23 Identities = 47/50 (94%), Positives = 49/50 (98%) Frame = -2 Query: 151 KSLAPGFRFHPTDEELVTYYLRRKACGKPFRFQAVSEIDVYKSEPWDLAG 2 KSLAPGFRFHPTDEELV YYLRRKACGKPFRFQAV+EIDVYKSEPW+LAG Sbjct: 24 KSLAPGFRFHPTDEELVRYYLRRKACGKPFRFQAVTEIDVYKSEPWELAG 73 >ref|XP_017236344.1| PREDICTED: NAC domain-containing protein 78 isoform X1 [Daucus carota subsp. sativus] gb|KZN05558.1| hypothetical protein DCAR_006395 [Daucus carota subsp. sativus] Length = 404 Score = 104 bits (259), Expect = 4e-23 Identities = 47/50 (94%), Positives = 49/50 (98%) Frame = -2 Query: 151 KSLAPGFRFHPTDEELVTYYLRRKACGKPFRFQAVSEIDVYKSEPWDLAG 2 KSLAPGFRFHPTDEELV YYLRRKACGKPFRFQAV+EIDVYKSEPW+LAG Sbjct: 24 KSLAPGFRFHPTDEELVRYYLRRKACGKPFRFQAVTEIDVYKSEPWELAG 73 >ref|XP_022856339.1| NAC domain containing protein 50-like [Olea europaea var. sylvestris] Length = 405 Score = 102 bits (254), Expect = 2e-22 Identities = 46/48 (95%), Positives = 48/48 (100%) Frame = -2 Query: 148 SLAPGFRFHPTDEELVTYYLRRKACGKPFRFQAVSEIDVYKSEPWDLA 5 SLAPGFRFHPTDEELVTYYLRRKACGKPFRFQAV+EIDVYKSEPW+LA Sbjct: 25 SLAPGFRFHPTDEELVTYYLRRKACGKPFRFQAVTEIDVYKSEPWELA 72 >ref|XP_022006100.1| NAC domain-containing protein 78-like [Helianthus annuus] gb|OTF99366.1| putative NAC domain-containing protein [Helianthus annuus] Length = 397 Score = 102 bits (253), Expect = 3e-22 Identities = 45/49 (91%), Positives = 47/49 (95%) Frame = -2 Query: 148 SLAPGFRFHPTDEELVTYYLRRKACGKPFRFQAVSEIDVYKSEPWDLAG 2 SLAPGFRFHPTDEELV YYLRRK CGKPFRF+AVSE+DVYKSEPWDLAG Sbjct: 26 SLAPGFRFHPTDEELVRYYLRRKVCGKPFRFEAVSEVDVYKSEPWDLAG 74 >ref|XP_022859886.1| NAC domain containing protein 50-like [Olea europaea var. sylvestris] Length = 387 Score = 101 bits (251), Expect = 5e-22 Identities = 46/48 (95%), Positives = 47/48 (97%) Frame = -2 Query: 148 SLAPGFRFHPTDEELVTYYLRRKACGKPFRFQAVSEIDVYKSEPWDLA 5 SLAPGFRFHPTDEELV YYLRRKACGKPFRFQAVSEIDVYKSEPW+LA Sbjct: 18 SLAPGFRFHPTDEELVRYYLRRKACGKPFRFQAVSEIDVYKSEPWELA 65 >ref|XP_023762705.1| NAC domain containing protein 52-like [Lactuca sativa] gb|PLY86353.1| hypothetical protein LSAT_8X17420 [Lactuca sativa] Length = 391 Score = 101 bits (251), Expect = 5e-22 Identities = 46/48 (95%), Positives = 47/48 (97%) Frame = -2 Query: 148 SLAPGFRFHPTDEELVTYYLRRKACGKPFRFQAVSEIDVYKSEPWDLA 5 SLAPGFRFHPTDEELV YYLRRKACGKPFRFQAVSEIDVYKSEPW+LA Sbjct: 25 SLAPGFRFHPTDEELVMYYLRRKACGKPFRFQAVSEIDVYKSEPWELA 72 >ref|XP_017252139.1| PREDICTED: NAC domain-containing protein 78 isoform X2 [Daucus carota subsp. sativus] Length = 395 Score = 101 bits (251), Expect = 5e-22 Identities = 46/50 (92%), Positives = 47/50 (94%) Frame = -2 Query: 151 KSLAPGFRFHPTDEELVTYYLRRKACGKPFRFQAVSEIDVYKSEPWDLAG 2 K LAPGFRFHPTDEELV YYL RKACGKPFRFQAVSEIDVYKSEPW+LAG Sbjct: 23 KCLAPGFRFHPTDEELVRYYLTRKACGKPFRFQAVSEIDVYKSEPWELAG 72 >ref|XP_017252138.1| PREDICTED: NAC domain-containing protein 78 isoform X1 [Daucus carota subsp. sativus] Length = 398 Score = 101 bits (251), Expect = 5e-22 Identities = 46/50 (92%), Positives = 47/50 (94%) Frame = -2 Query: 151 KSLAPGFRFHPTDEELVTYYLRRKACGKPFRFQAVSEIDVYKSEPWDLAG 2 K LAPGFRFHPTDEELV YYL RKACGKPFRFQAVSEIDVYKSEPW+LAG Sbjct: 23 KCLAPGFRFHPTDEELVRYYLTRKACGKPFRFQAVSEIDVYKSEPWELAG 72 >ref|XP_019198774.1| PREDICTED: NAC domain-containing protein 78-like [Ipomoea nil] Length = 400 Score = 101 bits (251), Expect = 5e-22 Identities = 46/48 (95%), Positives = 47/48 (97%) Frame = -2 Query: 148 SLAPGFRFHPTDEELVTYYLRRKACGKPFRFQAVSEIDVYKSEPWDLA 5 SLAPGFRFHPTDEELV YYLRRKACGKPFRFQAVSEIDVYKSEPW+LA Sbjct: 27 SLAPGFRFHPTDEELVRYYLRRKACGKPFRFQAVSEIDVYKSEPWELA 74 >gb|KZM95834.1| hypothetical protein DCAR_019076 [Daucus carota subsp. sativus] Length = 400 Score = 101 bits (251), Expect = 5e-22 Identities = 46/50 (92%), Positives = 47/50 (94%) Frame = -2 Query: 151 KSLAPGFRFHPTDEELVTYYLRRKACGKPFRFQAVSEIDVYKSEPWDLAG 2 K LAPGFRFHPTDEELV YYL RKACGKPFRFQAVSEIDVYKSEPW+LAG Sbjct: 23 KCLAPGFRFHPTDEELVRYYLTRKACGKPFRFQAVSEIDVYKSEPWELAG 72 >gb|AFP93563.1| NAC [Cestrum nocturnum] Length = 414 Score = 101 bits (251), Expect = 6e-22 Identities = 46/48 (95%), Positives = 47/48 (97%) Frame = -2 Query: 148 SLAPGFRFHPTDEELVTYYLRRKACGKPFRFQAVSEIDVYKSEPWDLA 5 SLAPGFRFHPTDEELV YYLRRKACGKPFRFQAVSEIDVYKSEPW+LA Sbjct: 27 SLAPGFRFHPTDEELVRYYLRRKACGKPFRFQAVSEIDVYKSEPWELA 74 >gb|EPS65704.1| nam-like protein 4, partial [Genlisea aurea] Length = 224 Score = 97.8 bits (242), Expect = 7e-22 Identities = 44/48 (91%), Positives = 46/48 (95%) Frame = -2 Query: 148 SLAPGFRFHPTDEELVTYYLRRKACGKPFRFQAVSEIDVYKSEPWDLA 5 SLAPGFRFHPTDEELV YYLRRKAC KPFRFQAV+EIDVYKSEPW+LA Sbjct: 22 SLAPGFRFHPTDEELVRYYLRRKACAKPFRFQAVAEIDVYKSEPWELA 69 >ref|XP_021976900.1| NAC domain-containing protein 78-like [Helianthus annuus] gb|OTG17989.1| putative NAC domain-containing protein [Helianthus annuus] Length = 377 Score = 100 bits (248), Expect = 1e-21 Identities = 45/48 (93%), Positives = 47/48 (97%) Frame = -2 Query: 148 SLAPGFRFHPTDEELVTYYLRRKACGKPFRFQAVSEIDVYKSEPWDLA 5 SLAPGFRFHPTDEELV YYLRRKACGKPFRFQAV+EIDVYKSEPW+LA Sbjct: 24 SLAPGFRFHPTDEELVMYYLRRKACGKPFRFQAVTEIDVYKSEPWELA 71 >ref|XP_022841474.1| NAC domain containing protein 50-like isoform X2 [Olea europaea var. sylvestris] Length = 390 Score = 100 bits (248), Expect = 1e-21 Identities = 45/48 (93%), Positives = 47/48 (97%) Frame = -2 Query: 148 SLAPGFRFHPTDEELVTYYLRRKACGKPFRFQAVSEIDVYKSEPWDLA 5 SLAPGFRFHPTDEELV YYLRRKACGKPFRFQAV+EIDVYKSEPW+LA Sbjct: 25 SLAPGFRFHPTDEELVRYYLRRKACGKPFRFQAVTEIDVYKSEPWELA 72 >ref|XP_022841473.1| NAC domain containing protein 50-like isoform X1 [Olea europaea var. sylvestris] Length = 391 Score = 100 bits (248), Expect = 1e-21 Identities = 45/48 (93%), Positives = 47/48 (97%) Frame = -2 Query: 148 SLAPGFRFHPTDEELVTYYLRRKACGKPFRFQAVSEIDVYKSEPWDLA 5 SLAPGFRFHPTDEELV YYLRRKACGKPFRFQAV+EIDVYKSEPW+LA Sbjct: 25 SLAPGFRFHPTDEELVRYYLRRKACGKPFRFQAVTEIDVYKSEPWELA 72 >gb|PIN24472.1| hypothetical protein CDL12_02823 [Handroanthus impetiginosus] Length = 395 Score = 100 bits (248), Expect = 1e-21 Identities = 45/48 (93%), Positives = 47/48 (97%) Frame = -2 Query: 148 SLAPGFRFHPTDEELVTYYLRRKACGKPFRFQAVSEIDVYKSEPWDLA 5 SLAPGFRFHPTDEELV YYLRRKACGKPFRFQAV+EIDVYKSEPW+LA Sbjct: 23 SLAPGFRFHPTDEELVRYYLRRKACGKPFRFQAVTEIDVYKSEPWELA 70 >ref|XP_011076898.1| NAC domain-containing protein 78-like [Sesamum indicum] Length = 397 Score = 100 bits (248), Expect = 1e-21 Identities = 45/48 (93%), Positives = 47/48 (97%) Frame = -2 Query: 148 SLAPGFRFHPTDEELVTYYLRRKACGKPFRFQAVSEIDVYKSEPWDLA 5 SLAPGFRFHPTDEELV YYLRRKACGKPFRFQAV+EIDVYKSEPW+LA Sbjct: 26 SLAPGFRFHPTDEELVRYYLRRKACGKPFRFQAVTEIDVYKSEPWELA 73 >ref|XP_019232053.1| PREDICTED: NAC domain-containing protein 78-like [Nicotiana attenuata] gb|OIT28307.1| nac domain-containing protein 78 [Nicotiana attenuata] Length = 398 Score = 100 bits (248), Expect = 1e-21 Identities = 45/48 (93%), Positives = 47/48 (97%) Frame = -2 Query: 148 SLAPGFRFHPTDEELVTYYLRRKACGKPFRFQAVSEIDVYKSEPWDLA 5 SLAPGFRFHPTDEELV YYLRRKACGKPFRFQAV+EIDVYKSEPW+LA Sbjct: 27 SLAPGFRFHPTDEELVRYYLRRKACGKPFRFQAVTEIDVYKSEPWELA 74 >ref|XP_009625487.1| PREDICTED: NAC domain-containing protein 78-like [Nicotiana tomentosiformis] Length = 398 Score = 100 bits (248), Expect = 1e-21 Identities = 45/48 (93%), Positives = 47/48 (97%) Frame = -2 Query: 148 SLAPGFRFHPTDEELVTYYLRRKACGKPFRFQAVSEIDVYKSEPWDLA 5 SLAPGFRFHPTDEELV YYLRRKACGKPFRFQAV+EIDVYKSEPW+LA Sbjct: 27 SLAPGFRFHPTDEELVRYYLRRKACGKPFRFQAVTEIDVYKSEPWELA 74 >ref|XP_009796718.1| PREDICTED: NAC domain-containing protein 78-like [Nicotiana sylvestris] ref|XP_016464323.1| PREDICTED: NAC domain-containing protein 78-like [Nicotiana tabacum] Length = 399 Score = 100 bits (248), Expect = 1e-21 Identities = 45/48 (93%), Positives = 47/48 (97%) Frame = -2 Query: 148 SLAPGFRFHPTDEELVTYYLRRKACGKPFRFQAVSEIDVYKSEPWDLA 5 SLAPGFRFHPTDEELV YYLRRKACGKPFRFQAV+EIDVYKSEPW+LA Sbjct: 28 SLAPGFRFHPTDEELVRYYLRRKACGKPFRFQAVTEIDVYKSEPWELA 75