BLASTX nr result
ID: Acanthopanax24_contig00024878
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Acanthopanax24_contig00024878 (427 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PKI53793.1| hypothetical protein CRG98_025799 [Punica granatum] 60 7e-09 ref|XP_022002411.1| pentatricopeptide repeat-containing protein ... 60 1e-08 ref|XP_022002413.1| pentatricopeptide repeat-containing protein ... 60 1e-08 ref|XP_022002410.1| pentatricopeptide repeat-containing protein ... 60 4e-08 ref|XP_022002412.1| pentatricopeptide repeat-containing protein ... 60 4e-08 ref|XP_020106848.1| pentatricopeptide repeat-containing protein ... 60 5e-08 gb|OAY71773.1| Pentatricopeptide repeat-containing protein [Anan... 60 5e-08 gb|OTG03035.1| putative pentatricopeptide repeat protein [Helian... 60 6e-08 ref|XP_002272799.2| PREDICTED: pentatricopeptide repeat-containi... 60 7e-08 gb|PLY72643.1| hypothetical protein LSAT_3X109820 [Lactuca sativa] 59 1e-07 ref|XP_023735347.1| pentatricopeptide repeat-containing protein ... 59 1e-07 ref|XP_018724634.1| PREDICTED: pentatricopeptide repeat-containi... 58 3e-07 ref|XP_009413433.1| PREDICTED: pentatricopeptide repeat-containi... 58 4e-07 ref|XP_018685382.1| PREDICTED: uncharacterized protein LOC103994... 58 4e-07 gb|PKA56257.1| Pentatricopeptide repeat-containing protein [Apos... 57 9e-07 ref|XP_015902092.1| PREDICTED: pentatricopeptide repeat-containi... 55 3e-06 ref|XP_015869106.1| PREDICTED: pentatricopeptide repeat-containi... 55 3e-06 ref|XP_008800347.2| PREDICTED: pentatricopeptide repeat-containi... 55 4e-06 ref|XP_010907823.1| PREDICTED: pentatricopeptide repeat-containi... 55 5e-06 ref|XP_020674174.1| pentatricopeptide repeat-containing protein ... 55 5e-06 >gb|PKI53793.1| hypothetical protein CRG98_025799 [Punica granatum] Length = 118 Score = 60.1 bits (144), Expect = 7e-09 Identities = 26/36 (72%), Positives = 33/36 (91%) Frame = +1 Query: 1 LAASVKKDCSEYLDSPKKFLKEVGRKYPKRRSLNLV 108 LAA+VKK+C EY+DSP+KFL+E RKYPKR+S+NLV Sbjct: 83 LAANVKKECYEYMDSPRKFLEEAQRKYPKRKSINLV 118 >ref|XP_022002411.1| pentatricopeptide repeat-containing protein At3g53170-like isoform X2 [Helianthus annuus] Length = 161 Score = 60.5 bits (145), Expect = 1e-08 Identities = 29/36 (80%), Positives = 30/36 (83%) Frame = +1 Query: 1 LAASVKKDCSEYLDSPKKFLKEVGRKYPKRRSLNLV 108 LAA VK DC EYLDSPKKFLKEV R+YPKR LNLV Sbjct: 126 LAAVVKNDCVEYLDSPKKFLKEVARRYPKRLRLNLV 161 >ref|XP_022002413.1| pentatricopeptide repeat-containing protein At3g53170-like isoform X2 [Helianthus annuus] Length = 161 Score = 60.5 bits (145), Expect = 1e-08 Identities = 29/36 (80%), Positives = 30/36 (83%) Frame = +1 Query: 1 LAASVKKDCSEYLDSPKKFLKEVGRKYPKRRSLNLV 108 LAA VK DC EYLDSPKKFLKEV R+YPKR LNLV Sbjct: 126 LAAVVKNDCVEYLDSPKKFLKEVARRYPKRLRLNLV 161 >ref|XP_022002410.1| pentatricopeptide repeat-containing protein At1g62350-like isoform X1 [Helianthus annuus] Length = 244 Score = 60.5 bits (145), Expect = 4e-08 Identities = 29/36 (80%), Positives = 30/36 (83%) Frame = +1 Query: 1 LAASVKKDCSEYLDSPKKFLKEVGRKYPKRRSLNLV 108 LAA VK DC EYLDSPKKFLKEV R+YPKR LNLV Sbjct: 209 LAAVVKNDCVEYLDSPKKFLKEVARRYPKRLRLNLV 244 >ref|XP_022002412.1| pentatricopeptide repeat-containing protein At1g62350-like isoform X1 [Helianthus annuus] Length = 244 Score = 60.5 bits (145), Expect = 4e-08 Identities = 29/36 (80%), Positives = 30/36 (83%) Frame = +1 Query: 1 LAASVKKDCSEYLDSPKKFLKEVGRKYPKRRSLNLV 108 LAA VK DC EYLDSPKKFLKEV R+YPKR LNLV Sbjct: 209 LAAVVKNDCVEYLDSPKKFLKEVARRYPKRLRLNLV 244 >ref|XP_020106848.1| pentatricopeptide repeat-containing protein At3g46870-like [Ananas comosus] Length = 246 Score = 60.1 bits (144), Expect = 5e-08 Identities = 27/36 (75%), Positives = 32/36 (88%) Frame = +1 Query: 1 LAASVKKDCSEYLDSPKKFLKEVGRKYPKRRSLNLV 108 LA+SV+KDC EY+D P+KFL+EV RKYPKRRSL LV Sbjct: 211 LASSVRKDCEEYIDFPEKFLEEVDRKYPKRRSLKLV 246 >gb|OAY71773.1| Pentatricopeptide repeat-containing protein [Ananas comosus] Length = 246 Score = 60.1 bits (144), Expect = 5e-08 Identities = 27/36 (75%), Positives = 32/36 (88%) Frame = +1 Query: 1 LAASVKKDCSEYLDSPKKFLKEVGRKYPKRRSLNLV 108 LA+SV+KDC EY+D P+KFL+EV RKYPKRRSL LV Sbjct: 211 LASSVRKDCEEYIDFPEKFLEEVDRKYPKRRSLKLV 246 >gb|OTG03035.1| putative pentatricopeptide repeat protein [Helianthus annuus] Length = 306 Score = 60.5 bits (145), Expect = 6e-08 Identities = 29/36 (80%), Positives = 30/36 (83%) Frame = +1 Query: 1 LAASVKKDCSEYLDSPKKFLKEVGRKYPKRRSLNLV 108 LAA VK DC EYLDSPKKFLKEV R+YPKR LNLV Sbjct: 271 LAAVVKNDCVEYLDSPKKFLKEVARRYPKRLRLNLV 306 >ref|XP_002272799.2| PREDICTED: pentatricopeptide repeat-containing protein At1g62350 isoform X3 [Vitis vinifera] emb|CBI24637.3| unnamed protein product, partial [Vitis vinifera] Length = 242 Score = 59.7 bits (143), Expect = 7e-08 Identities = 26/36 (72%), Positives = 32/36 (88%) Frame = +1 Query: 1 LAASVKKDCSEYLDSPKKFLKEVGRKYPKRRSLNLV 108 LAA VKK+C EY+D PKKFL+E+ +KYPKRRS+NLV Sbjct: 207 LAAGVKKECEEYVDYPKKFLEEIEKKYPKRRSVNLV 242 >gb|PLY72643.1| hypothetical protein LSAT_3X109820 [Lactuca sativa] Length = 242 Score = 58.9 bits (141), Expect = 1e-07 Identities = 27/36 (75%), Positives = 30/36 (83%) Frame = +1 Query: 1 LAASVKKDCSEYLDSPKKFLKEVGRKYPKRRSLNLV 108 LA+ +K DC EYLDSPKKFLKEV RKYP+R LNLV Sbjct: 207 LASIIKNDCVEYLDSPKKFLKEVARKYPRRLRLNLV 242 >ref|XP_023735347.1| pentatricopeptide repeat-containing protein At1g62350-like [Lactuca sativa] Length = 246 Score = 58.9 bits (141), Expect = 1e-07 Identities = 27/36 (75%), Positives = 30/36 (83%) Frame = +1 Query: 1 LAASVKKDCSEYLDSPKKFLKEVGRKYPKRRSLNLV 108 LA+ +K DC EYLDSPKKFLKEV RKYP+R LNLV Sbjct: 211 LASIIKNDCVEYLDSPKKFLKEVARKYPRRLRLNLV 246 >ref|XP_018724634.1| PREDICTED: pentatricopeptide repeat-containing protein At1g62350 [Eucalyptus grandis] gb|KCW87631.1| hypothetical protein EUGRSUZ_A00034 [Eucalyptus grandis] Length = 236 Score = 57.8 bits (138), Expect = 3e-07 Identities = 27/36 (75%), Positives = 30/36 (83%) Frame = +1 Query: 1 LAASVKKDCSEYLDSPKKFLKEVGRKYPKRRSLNLV 108 L VK+DC EYLDSPKKFL+EV RKYPKRRS +LV Sbjct: 201 LVEFVKRDCVEYLDSPKKFLEEVERKYPKRRSFDLV 236 >ref|XP_009413433.1| PREDICTED: pentatricopeptide repeat-containing protein At1g62350-like isoform X2 [Musa acuminata subsp. malaccensis] Length = 247 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/36 (69%), Positives = 32/36 (88%) Frame = +1 Query: 1 LAASVKKDCSEYLDSPKKFLKEVGRKYPKRRSLNLV 108 LA+ V+KDC+EY+D P+KFLKEV +K+PKRRSL LV Sbjct: 212 LASDVRKDCAEYMDFPEKFLKEVDKKFPKRRSLKLV 247 >ref|XP_018685382.1| PREDICTED: uncharacterized protein LOC103994732 isoform X1 [Musa acuminata subsp. malaccensis] Length = 265 Score = 57.8 bits (138), Expect = 4e-07 Identities = 25/36 (69%), Positives = 32/36 (88%) Frame = +1 Query: 1 LAASVKKDCSEYLDSPKKFLKEVGRKYPKRRSLNLV 108 LA+ V+KDC+EY+D P+KFLKEV +K+PKRRSL LV Sbjct: 230 LASDVRKDCAEYMDFPEKFLKEVDKKFPKRRSLKLV 265 >gb|PKA56257.1| Pentatricopeptide repeat-containing protein [Apostasia shenzhenica] Length = 296 Score = 57.0 bits (136), Expect = 9e-07 Identities = 24/36 (66%), Positives = 31/36 (86%) Frame = +1 Query: 1 LAASVKKDCSEYLDSPKKFLKEVGRKYPKRRSLNLV 108 LA +++ DC +YLDSP+KFL+EV +KYPKRRSL LV Sbjct: 261 LAVAIRSDCEQYLDSPEKFLEEVDKKYPKRRSLKLV 296 >ref|XP_015902092.1| PREDICTED: pentatricopeptide repeat-containing protein At1g62350-like [Ziziphus jujuba] Length = 252 Score = 55.5 bits (132), Expect = 3e-06 Identities = 24/36 (66%), Positives = 33/36 (91%) Frame = +1 Query: 1 LAASVKKDCSEYLDSPKKFLKEVGRKYPKRRSLNLV 108 L AS+KK+ +EY+DSP++FL+EV +K+PKRRSLNLV Sbjct: 217 LLASIKKEVAEYVDSPEQFLREVAKKHPKRRSLNLV 252 >ref|XP_015869106.1| PREDICTED: pentatricopeptide repeat-containing protein At1g62350-like [Ziziphus jujuba] Length = 252 Score = 55.5 bits (132), Expect = 3e-06 Identities = 24/36 (66%), Positives = 33/36 (91%) Frame = +1 Query: 1 LAASVKKDCSEYLDSPKKFLKEVGRKYPKRRSLNLV 108 L AS+KK+ +EY+DSP++FL+EV +K+PKRRSLNLV Sbjct: 217 LLASIKKEVAEYVDSPEQFLREVAKKHPKRRSLNLV 252 >ref|XP_008800347.2| PREDICTED: pentatricopeptide repeat-containing protein At3g46870-like isoform X2 [Phoenix dactylifera] Length = 253 Score = 55.1 bits (131), Expect = 4e-06 Identities = 23/36 (63%), Positives = 33/36 (91%) Frame = +1 Query: 1 LAASVKKDCSEYLDSPKKFLKEVGRKYPKRRSLNLV 108 LA++V+K+C+EY+D P+KFL+EV +K+PKRRSL LV Sbjct: 218 LASAVRKECAEYMDFPEKFLEEVDKKFPKRRSLELV 253 >ref|XP_010907823.1| PREDICTED: pentatricopeptide repeat-containing protein At3g46870-like [Elaeis guineensis] Length = 253 Score = 54.7 bits (130), Expect = 5e-06 Identities = 23/36 (63%), Positives = 33/36 (91%) Frame = +1 Query: 1 LAASVKKDCSEYLDSPKKFLKEVGRKYPKRRSLNLV 108 LA++V+K+C+EY+D P+KFL+EV +K+PKRRSL LV Sbjct: 218 LASAVRKECAEYVDFPEKFLEEVDKKFPKRRSLELV 253 >ref|XP_020674174.1| pentatricopeptide repeat-containing protein At1g62350-like [Dendrobium catenatum] Length = 262 Score = 54.7 bits (130), Expect = 5e-06 Identities = 22/36 (61%), Positives = 32/36 (88%) Frame = +1 Query: 1 LAASVKKDCSEYLDSPKKFLKEVGRKYPKRRSLNLV 108 LA SV++DC +Y+DSP+KFL+E+ ++YPKRRS+ LV Sbjct: 227 LAISVRRDCKQYIDSPEKFLQELDKEYPKRRSIKLV 262