BLASTX nr result
ID: Acanthopanax24_contig00023901
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Acanthopanax24_contig00023901 (432 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KZM93467.1| hypothetical protein DCAR_016712 [Daucus carota s... 57 2e-08 >gb|KZM93467.1| hypothetical protein DCAR_016712 [Daucus carota subsp. sativus] Length = 67 Score = 57.4 bits (137), Expect = 2e-08 Identities = 25/40 (62%), Positives = 33/40 (82%) Frame = -3 Query: 397 MALLTNFFNCFSENSVADSRGFVCNGDVCILRDRKASQGV 278 MALL NFF+CF E+S D+R +VCNGDVC++RD K S+G+ Sbjct: 1 MALLNNFFSCFHESS-PDTRQYVCNGDVCVMRDPKPSEGI 39