BLASTX nr result
ID: Acanthopanax24_contig00023894
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Acanthopanax24_contig00023894 (423 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_017222625.1| PREDICTED: probable UDP-N-acetylglucosamine-... 70 3e-11 >ref|XP_017222625.1| PREDICTED: probable UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase SEC [Daucus carota subsp. sativus] gb|KZM85908.1| hypothetical protein DCAR_026670 [Daucus carota subsp. sativus] Length = 982 Score = 70.1 bits (170), Expect = 3e-11 Identities = 36/55 (65%), Positives = 41/55 (74%), Gaps = 5/55 (9%) Frame = +2 Query: 50 MLSLQNDLRQLHLQQ-----VPRVAYNGDHRDDPFLLHSESASSIKLAHGLDARE 199 MLS+QNDLRQL LQQ VPRV GDHR+DPFLLHSE S +++ GLDARE Sbjct: 1 MLSVQNDLRQLQLQQQQQMVVPRVYNTGDHRNDPFLLHSEPVSGLRIGAGLDARE 55