BLASTX nr result
ID: Acanthopanax24_contig00023784
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Acanthopanax24_contig00023784 (427 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KZN07778.1| hypothetical protein DCAR_008615 [Daucus carota s... 99 4e-21 ref|XP_017231116.1| PREDICTED: LOW QUALITY PROTEIN: AT-rich inte... 99 4e-21 gb|KZN06098.1| hypothetical protein DCAR_006935 [Daucus carota s... 93 4e-20 ref|XP_017232425.1| PREDICTED: AT-rich interactive domain-contai... 93 4e-19 ref|XP_017232424.1| PREDICTED: AT-rich interactive domain-contai... 93 4e-19 ref|XP_020547578.1| AT-rich interactive domain-containing protei... 87 4e-17 ref|XP_019158724.1| PREDICTED: AT-rich interactive domain-contai... 80 8e-15 gb|PHU04546.1| hypothetical protein BC332_25368 [Capsicum chinense] 79 1e-14 gb|PHT35872.1| hypothetical protein CQW23_23572 [Capsicum baccatum] 79 3e-14 ref|XP_016545492.1| PREDICTED: AT-rich interactive domain-contai... 79 3e-14 ref|XP_016440025.1| PREDICTED: AT-rich interactive domain-contai... 78 6e-14 ref|XP_019252191.1| PREDICTED: AT-rich interactive domain-contai... 78 6e-14 ref|XP_009783361.1| PREDICTED: AT-rich interactive domain-contai... 78 6e-14 ref|XP_009617230.1| PREDICTED: AT-rich interactive domain-contai... 78 6e-14 ref|XP_012843760.1| PREDICTED: AT-rich interactive domain-contai... 77 1e-13 gb|EYU32146.1| hypothetical protein MIMGU_mgv1a018438mg, partial... 77 1e-13 gb|PIN18587.1| hypothetical protein CDL12_08741 [Handroanthus im... 77 1e-13 ref|XP_009367806.1| PREDICTED: AT-rich interactive domain-contai... 77 2e-13 ref|XP_010275662.1| PREDICTED: AT-rich interactive domain-contai... 76 2e-13 gb|ABH02885.1| MYB transcription factor MYB165, partial [Glycine... 71 6e-13 >gb|KZN07778.1| hypothetical protein DCAR_008615 [Daucus carota subsp. sativus] Length = 634 Score = 98.6 bits (244), Expect = 4e-21 Identities = 48/64 (75%), Positives = 51/64 (79%) Frame = -1 Query: 427 LVSYYFNVFLLRRRGQQNRSTPIEINSDDDEPEFGSATNCIGQGAMKSSGSIYCSPNKTR 248 LVSYYFNVFLLRRRG QNRS PIEI+SDDD+ EF + TNC G GAMKS YCSP KT Sbjct: 565 LVSYYFNVFLLRRRGLQNRSIPIEISSDDDDLEFETTTNCSGHGAMKSPKFNYCSPKKTH 624 Query: 247 LNFR 236 LNFR Sbjct: 625 LNFR 628 >ref|XP_017231116.1| PREDICTED: LOW QUALITY PROTEIN: AT-rich interactive domain-containing protein 2 [Daucus carota subsp. sativus] Length = 666 Score = 98.6 bits (244), Expect = 4e-21 Identities = 48/64 (75%), Positives = 51/64 (79%) Frame = -1 Query: 427 LVSYYFNVFLLRRRGQQNRSTPIEINSDDDEPEFGSATNCIGQGAMKSSGSIYCSPNKTR 248 LVSYYFNVFLLRRRG QNRS PIEI+SDDD+ EF + TNC G GAMKS YCSP KT Sbjct: 597 LVSYYFNVFLLRRRGLQNRSIPIEISSDDDDLEFETTTNCSGHGAMKSPKFNYCSPKKTH 656 Query: 247 LNFR 236 LNFR Sbjct: 657 LNFR 660 >gb|KZN06098.1| hypothetical protein DCAR_006935 [Daucus carota subsp. sativus] Length = 269 Score = 92.8 bits (229), Expect = 4e-20 Identities = 44/64 (68%), Positives = 50/64 (78%) Frame = -1 Query: 427 LVSYYFNVFLLRRRGQQNRSTPIEINSDDDEPEFGSATNCIGQGAMKSSGSIYCSPNKTR 248 LVSYYFNVFLLRRRG QNRS PIEI+SDDD+ +F + TNC GQ ++S YCSP KT Sbjct: 206 LVSYYFNVFLLRRRGLQNRSIPIEISSDDDDLDFETTTNCSGQTVVRSPKPSYCSPKKTH 265 Query: 247 LNFR 236 LNFR Sbjct: 266 LNFR 269 >ref|XP_017232425.1| PREDICTED: AT-rich interactive domain-containing protein 1-like isoform X2 [Daucus carota subsp. sativus] Length = 628 Score = 92.8 bits (229), Expect = 4e-19 Identities = 44/64 (68%), Positives = 50/64 (78%) Frame = -1 Query: 427 LVSYYFNVFLLRRRGQQNRSTPIEINSDDDEPEFGSATNCIGQGAMKSSGSIYCSPNKTR 248 LVSYYFNVFLLRRRG QNRS PIEI+SDDD+ +F + TNC GQ ++S YCSP KT Sbjct: 565 LVSYYFNVFLLRRRGLQNRSIPIEISSDDDDLDFETTTNCSGQTVVRSPKPSYCSPKKTH 624 Query: 247 LNFR 236 LNFR Sbjct: 625 LNFR 628 >ref|XP_017232424.1| PREDICTED: AT-rich interactive domain-containing protein 1-like isoform X1 [Daucus carota subsp. sativus] Length = 629 Score = 92.8 bits (229), Expect = 4e-19 Identities = 44/64 (68%), Positives = 50/64 (78%) Frame = -1 Query: 427 LVSYYFNVFLLRRRGQQNRSTPIEINSDDDEPEFGSATNCIGQGAMKSSGSIYCSPNKTR 248 LVSYYFNVFLLRRRG QNRS PIEI+SDDD+ +F + TNC GQ ++S YCSP KT Sbjct: 566 LVSYYFNVFLLRRRGLQNRSIPIEISSDDDDLDFETTTNCSGQTVVRSPKPSYCSPKKTH 625 Query: 247 LNFR 236 LNFR Sbjct: 626 LNFR 629 >ref|XP_020547578.1| AT-rich interactive domain-containing protein 1 [Sesamum indicum] Length = 590 Score = 87.0 bits (214), Expect = 4e-17 Identities = 43/64 (67%), Positives = 49/64 (76%) Frame = -1 Query: 427 LVSYYFNVFLLRRRGQQNRSTPIEINSDDDEPEFGSATNCIGQGAMKSSGSIYCSPNKTR 248 LVSYYFNVFLLRRRGQQNRS+ +I+SDD+E EFG N GQ A KS GSI+CSP K+ Sbjct: 527 LVSYYFNVFLLRRRGQQNRSSTSKIDSDDEESEFGPIANKFGQIAAKSPGSIFCSPKKSH 586 Query: 247 LNFR 236 N R Sbjct: 587 SNSR 590 >ref|XP_019158724.1| PREDICTED: AT-rich interactive domain-containing protein 1 [Ipomoea nil] Length = 584 Score = 80.5 bits (197), Expect = 8e-15 Identities = 38/58 (65%), Positives = 44/58 (75%) Frame = -1 Query: 427 LVSYYFNVFLLRRRGQQNRSTPIEINSDDDEPEFGSATNCIGQGAMKSSGSIYCSPNK 254 LVSY+FNVFLLRRRG QNR TP EI+SDDDE +G T G+ +KSS SI+CSP K Sbjct: 522 LVSYHFNVFLLRRRGHQNRFTPTEIDSDDDESRYGPRTKSFGREVVKSSNSIFCSPAK 579 >gb|PHU04546.1| hypothetical protein BC332_25368 [Capsicum chinense] Length = 286 Score = 78.6 bits (192), Expect = 1e-14 Identities = 38/62 (61%), Positives = 46/62 (74%) Frame = -1 Query: 427 LVSYYFNVFLLRRRGQQNRSTPIEINSDDDEPEFGSATNCIGQGAMKSSGSIYCSPNKTR 248 LVSY+FNVFLLRRRG QNR+T I+SDDDEP++G TNC G+ S SI+CSP K Sbjct: 226 LVSYHFNVFLLRRRGDQNRTTGSNIDSDDDEPQYGPRTNCFGR---DSEFSIFCSPKKAH 282 Query: 247 LN 242 L+ Sbjct: 283 LD 284 >gb|PHT35872.1| hypothetical protein CQW23_23572 [Capsicum baccatum] Length = 456 Score = 78.6 bits (192), Expect = 3e-14 Identities = 38/62 (61%), Positives = 46/62 (74%) Frame = -1 Query: 427 LVSYYFNVFLLRRRGQQNRSTPIEINSDDDEPEFGSATNCIGQGAMKSSGSIYCSPNKTR 248 LVSY+FNVFLLRRRG QNR+T I+SDDDEP++G TNC G+ S SI+CSP K Sbjct: 396 LVSYHFNVFLLRRRGDQNRTTGSNIDSDDDEPQYGPRTNCFGR---DSEFSIFCSPKKAH 452 Query: 247 LN 242 L+ Sbjct: 453 LD 454 >ref|XP_016545492.1| PREDICTED: AT-rich interactive domain-containing protein 1-like [Capsicum annuum] gb|PHT70015.1| hypothetical protein T459_25119 [Capsicum annuum] Length = 456 Score = 78.6 bits (192), Expect = 3e-14 Identities = 38/62 (61%), Positives = 46/62 (74%) Frame = -1 Query: 427 LVSYYFNVFLLRRRGQQNRSTPIEINSDDDEPEFGSATNCIGQGAMKSSGSIYCSPNKTR 248 LVSY+FNVFLLRRRG QNR+T I+SDDDEP++G TNC G+ S SI+CSP K Sbjct: 396 LVSYHFNVFLLRRRGDQNRTTGSNIDSDDDEPQYGPRTNCFGR---DSEFSIFCSPKKAH 452 Query: 247 LN 242 L+ Sbjct: 453 LD 454 >ref|XP_016440025.1| PREDICTED: AT-rich interactive domain-containing protein 1-like isoform X2 [Nicotiana tabacum] Length = 463 Score = 77.8 bits (190), Expect = 6e-14 Identities = 39/64 (60%), Positives = 46/64 (71%) Frame = -1 Query: 427 LVSYYFNVFLLRRRGQQNRSTPIEINSDDDEPEFGSATNCIGQGAMKSSGSIYCSPNKTR 248 LVSY+FNVFLLRRRG QNR+ I+SDDDEPE+G TNC G+ S SI+CSP K Sbjct: 403 LVSYHFNVFLLRRRGHQNRTNASIIDSDDDEPEYGPRTNCFGR---DSKFSIFCSPRKDH 459 Query: 247 LNFR 236 L+ R Sbjct: 460 LDSR 463 >ref|XP_019252191.1| PREDICTED: AT-rich interactive domain-containing protein 1-like [Nicotiana attenuata] ref|XP_019252192.1| PREDICTED: AT-rich interactive domain-containing protein 1-like [Nicotiana attenuata] ref|XP_019252193.1| PREDICTED: AT-rich interactive domain-containing protein 1-like [Nicotiana attenuata] gb|OIS99460.1| at-rich interactive domain-containing protein 1 [Nicotiana attenuata] Length = 465 Score = 77.8 bits (190), Expect = 6e-14 Identities = 39/64 (60%), Positives = 46/64 (71%) Frame = -1 Query: 427 LVSYYFNVFLLRRRGQQNRSTPIEINSDDDEPEFGSATNCIGQGAMKSSGSIYCSPNKTR 248 LVSY+FNVFLLRRRG QNR+ I+SDDDEPE+G TNC G+ S SI+CSP K Sbjct: 405 LVSYHFNVFLLRRRGHQNRTNASIIDSDDDEPEYGPRTNCFGR---DSKFSIFCSPRKEH 461 Query: 247 LNFR 236 L+ R Sbjct: 462 LDSR 465 >ref|XP_009783361.1| PREDICTED: AT-rich interactive domain-containing protein 1-like [Nicotiana sylvestris] ref|XP_016471354.1| PREDICTED: AT-rich interactive domain-containing protein 1-like [Nicotiana tabacum] Length = 465 Score = 77.8 bits (190), Expect = 6e-14 Identities = 39/64 (60%), Positives = 46/64 (71%) Frame = -1 Query: 427 LVSYYFNVFLLRRRGQQNRSTPIEINSDDDEPEFGSATNCIGQGAMKSSGSIYCSPNKTR 248 LVSY+FNVFLLRRRG QNR+ I+SDDDEPE+G TNC G+ S SI+CSP K Sbjct: 405 LVSYHFNVFLLRRRGHQNRTNASIIDSDDDEPEYGPRTNCFGR---DSKFSIFCSPRKEH 461 Query: 247 LNFR 236 L+ R Sbjct: 462 LDSR 465 >ref|XP_009617230.1| PREDICTED: AT-rich interactive domain-containing protein 1-like [Nicotiana tomentosiformis] ref|XP_016440024.1| PREDICTED: AT-rich interactive domain-containing protein 1-like isoform X1 [Nicotiana tabacum] Length = 466 Score = 77.8 bits (190), Expect = 6e-14 Identities = 39/64 (60%), Positives = 46/64 (71%) Frame = -1 Query: 427 LVSYYFNVFLLRRRGQQNRSTPIEINSDDDEPEFGSATNCIGQGAMKSSGSIYCSPNKTR 248 LVSY+FNVFLLRRRG QNR+ I+SDDDEPE+G TNC G+ S SI+CSP K Sbjct: 406 LVSYHFNVFLLRRRGHQNRTNASIIDSDDDEPEYGPRTNCFGR---DSKFSIFCSPRKDH 462 Query: 247 LNFR 236 L+ R Sbjct: 463 LDSR 466 >ref|XP_012843760.1| PREDICTED: AT-rich interactive domain-containing protein 1 [Erythranthe guttata] Length = 405 Score = 77.0 bits (188), Expect = 1e-13 Identities = 39/59 (66%), Positives = 43/59 (72%) Frame = -1 Query: 427 LVSYYFNVFLLRRRGQQNRSTPIEINSDDDEPEFGSATNCIGQGAMKSSGSIYCSPNKT 251 LVSYYFNVFLLRRRG QNRS EI+SDD+E EFG N GQ A S GSI+ SP K+ Sbjct: 346 LVSYYFNVFLLRRRGFQNRSNTAEIHSDDEESEFGPIGNRFGQSAANSPGSIFRSPKKS 404 >gb|EYU32146.1| hypothetical protein MIMGU_mgv1a018438mg, partial [Erythranthe guttata] Length = 425 Score = 77.0 bits (188), Expect = 1e-13 Identities = 39/59 (66%), Positives = 43/59 (72%) Frame = -1 Query: 427 LVSYYFNVFLLRRRGQQNRSTPIEINSDDDEPEFGSATNCIGQGAMKSSGSIYCSPNKT 251 LVSYYFNVFLLRRRG QNRS EI+SDD+E EFG N GQ A S GSI+ SP K+ Sbjct: 366 LVSYYFNVFLLRRRGFQNRSNTAEIHSDDEESEFGPIGNRFGQSAANSPGSIFRSPKKS 424 >gb|PIN18587.1| hypothetical protein CDL12_08741 [Handroanthus impetiginosus] Length = 570 Score = 77.0 bits (188), Expect = 1e-13 Identities = 39/62 (62%), Positives = 43/62 (69%) Frame = -1 Query: 427 LVSYYFNVFLLRRRGQQNRSTPIEINSDDDEPEFGSATNCIGQGAMKSSGSIYCSPNKTR 248 LVSYYFNVFLLRRR NRS I+SDD+E EFG N GQ A S GSI+CSP K+ Sbjct: 507 LVSYYFNVFLLRRRIHHNRSNAGNIDSDDEESEFGPIANRFGQMAATSPGSIFCSPKKSH 566 Query: 247 LN 242 LN Sbjct: 567 LN 568 >ref|XP_009367806.1| PREDICTED: AT-rich interactive domain-containing protein 2 [Pyrus x bretschneideri] Length = 719 Score = 76.6 bits (187), Expect = 2e-13 Identities = 40/69 (57%), Positives = 47/69 (68%) Frame = -1 Query: 427 LVSYYFNVFLLRRRGQQNRSTPIEINSDDDEPEFGSATNCIGQGAMKSSGSIYCSPNKTR 248 LVSYYFNVFLL+RRG QNR TP +I+SDD+E E S TNC G KSS SI SP+K Sbjct: 649 LVSYYFNVFLLQRRGYQNRFTPNKIDSDDEELELESMTNCFGNEEHKSSKSILKSPHKPH 708 Query: 247 LNFREYSKM 221 R+ + M Sbjct: 709 AKHRKEASM 717 >ref|XP_010275662.1| PREDICTED: AT-rich interactive domain-containing protein 2-like [Nelumbo nucifera] Length = 607 Score = 76.3 bits (186), Expect = 2e-13 Identities = 38/69 (55%), Positives = 49/69 (71%), Gaps = 2/69 (2%) Frame = -1 Query: 427 LVSYYFNVFLLRRRGQQNRSTPIEINSDDDEPEFGSATNCIGQGAMKSSG--SIYCSPNK 254 LVSYYFNVFLLRRR QNR +P I+SDDDE EFGS +N G A+K +G S++C+ NK Sbjct: 538 LVSYYFNVFLLRRRSYQNRVSPNNIDSDDDESEFGSVSNGFGHEALKVAGSKSVFCAQNK 597 Query: 253 TRLNFREYS 227 ++ Y+ Sbjct: 598 QCVDLEGYT 606 >gb|ABH02885.1| MYB transcription factor MYB165, partial [Glycine max] Length = 123 Score = 70.9 bits (172), Expect = 6e-13 Identities = 34/60 (56%), Positives = 40/60 (66%) Frame = -1 Query: 427 LVSYYFNVFLLRRRGQQNRSTPIEINSDDDEPEFGSATNCIGQGAMKSSGSIYCSPNKTR 248 LVSYYFNVF+L RRG QNR TP INSDD++ E G N GQ S GSI +P K++ Sbjct: 60 LVSYYFNVFILERRGYQNRHTPNNINSDDEDDEAGPLRNVFGQQTQNSRGSILLTPKKSQ 119