BLASTX nr result
ID: Acanthopanax24_contig00023470
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Acanthopanax24_contig00023470 (495 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011466271.1| PREDICTED: nuclear pore complex protein NUP1... 81 3e-16 ref|XP_020217854.1| uncharacterized protein LOC109801241 [Cajanu... 82 4e-16 gb|PNX81855.1| nuclear pore complex protein Nup155-like protein,... 79 1e-15 ref|XP_017235270.1| PREDICTED: nuclear pore complex protein NUP1... 84 1e-15 ref|XP_015957217.1| nuclear pore complex protein NUP155 isoform ... 84 1e-15 gb|PIN16946.1| Nuclear pore complex, Nup155 component (D Nup154,... 84 1e-15 emb|CBI26832.3| unnamed protein product, partial [Vitis vinifera] 83 2e-15 ref|XP_021598438.1| nuclear pore complex protein NUP155 isoform ... 83 2e-15 ref|XP_021598437.1| nuclear pore complex protein NUP155 isoform ... 83 2e-15 gb|PNY14247.1| nuclear pore complex protein Nup155-like protein,... 83 3e-15 ref|XP_020534917.1| nuclear pore complex protein NUP155 isoform ... 83 3e-15 ref|XP_010501467.1| PREDICTED: nuclear pore complex protein NUP1... 83 3e-15 ref|XP_010462709.1| PREDICTED: nuclear pore complex protein NUP1... 83 3e-15 ref|XP_010652088.1| PREDICTED: nuclear pore complex protein NUP1... 83 3e-15 ref|XP_009148872.1| PREDICTED: nuclear pore complex protein NUP1... 83 3e-15 ref|XP_013586062.1| PREDICTED: nuclear pore complex protein NUP1... 83 3e-15 gb|KFK43755.1| hypothetical protein AALP_AA1G168700 [Arabis alpina] 83 3e-15 ref|XP_006416964.1| nuclear pore complex protein NUP155 [Eutrema... 83 3e-15 ref|XP_019095042.1| PREDICTED: nuclear pore complex protein NUP1... 83 3e-15 ref|XP_010476558.1| PREDICTED: nuclear pore complex protein NUP1... 83 3e-15 >ref|XP_011466271.1| PREDICTED: nuclear pore complex protein NUP155-like [Fragaria vesca subsp. vesca] Length = 175 Score = 81.3 bits (199), Expect = 3e-16 Identities = 36/45 (80%), Positives = 43/45 (95%) Frame = +2 Query: 350 DGQCPEYSGEEQDICVVGLAKAKAGIFVEAIQYLLVLATPVEVLM 484 DGQCPEYSGE+Q ICVVGLAK+K G+F+EAIQYLL+LATPV+VL+ Sbjct: 111 DGQCPEYSGEDQAICVVGLAKSKPGVFIEAIQYLLILATPVQVLI 155 >ref|XP_020217854.1| uncharacterized protein LOC109801241 [Cajanus cajan] Length = 208 Score = 82.0 bits (201), Expect = 4e-16 Identities = 38/48 (79%), Positives = 43/48 (89%) Frame = +2 Query: 344 HRDGQCPEYSGEEQDICVVGLAKAKAGIFVEAIQYLLVLATPVEVLMV 487 +RDGQCPEYSGEEQ IC VGLAK+K G+FVEA+QYLLVLATPVE + V Sbjct: 124 NRDGQCPEYSGEEQAICAVGLAKSKPGVFVEAMQYLLVLATPVETVAV 171 >gb|PNX81855.1| nuclear pore complex protein Nup155-like protein, partial [Trifolium pratense] Length = 152 Score = 79.3 bits (194), Expect = 1e-15 Identities = 37/42 (88%), Positives = 39/42 (92%) Frame = +2 Query: 350 DGQCPEYSGEEQDICVVGLAKAKAGIFVEAIQYLLVLATPVE 475 DGQCPEYSGEEQ IC VGLAK+K G+FVEAIQYLLVLATPVE Sbjct: 111 DGQCPEYSGEEQAICAVGLAKSKPGVFVEAIQYLLVLATPVE 152 >ref|XP_017235270.1| PREDICTED: nuclear pore complex protein NUP155 [Daucus carota subsp. sativus] gb|KZN06492.1| hypothetical protein DCAR_007329 [Daucus carota subsp. sativus] Length = 1463 Score = 83.6 bits (205), Expect = 1e-15 Identities = 38/46 (82%), Positives = 43/46 (93%) Frame = +2 Query: 350 DGQCPEYSGEEQDICVVGLAKAKAGIFVEAIQYLLVLATPVEVLMV 487 DGQCPEYSGEE+ IC VGLAKAK GIFVEAIQYLL+LATPVE+++V Sbjct: 111 DGQCPEYSGEEEAICAVGLAKAKPGIFVEAIQYLLILATPVEIILV 156 >ref|XP_015957217.1| nuclear pore complex protein NUP155 isoform X1 [Arachis duranensis] Length = 1485 Score = 83.6 bits (205), Expect = 1e-15 Identities = 38/46 (82%), Positives = 44/46 (95%) Frame = +2 Query: 350 DGQCPEYSGEEQDICVVGLAKAKAGIFVEAIQYLLVLATPVEVLMV 487 DGQCPEYSGEEQ IC VGLAK+K+G+FVEAIQYLLVLATPVE+++V Sbjct: 111 DGQCPEYSGEEQAICAVGLAKSKSGVFVEAIQYLLVLATPVELILV 156 >gb|PIN16946.1| Nuclear pore complex, Nup155 component (D Nup154, sc Nup157/Nup170) [Handroanthus impetiginosus] Length = 1497 Score = 83.6 bits (205), Expect = 1e-15 Identities = 38/46 (82%), Positives = 43/46 (93%) Frame = +2 Query: 350 DGQCPEYSGEEQDICVVGLAKAKAGIFVEAIQYLLVLATPVEVLMV 487 DGQCPEYSGEEQ IC VGLAKAK G+F+EAIQYLLVLATPVE+++V Sbjct: 112 DGQCPEYSGEEQAICAVGLAKAKPGVFIEAIQYLLVLATPVELILV 157 >emb|CBI26832.3| unnamed protein product, partial [Vitis vinifera] Length = 377 Score = 82.8 bits (203), Expect = 2e-15 Identities = 38/46 (82%), Positives = 43/46 (93%) Frame = +2 Query: 350 DGQCPEYSGEEQDICVVGLAKAKAGIFVEAIQYLLVLATPVEVLMV 487 DGQCPEYSGEEQ IC VGLAK+K G+FVEAIQYLLVLATPVE+++V Sbjct: 111 DGQCPEYSGEEQAICAVGLAKSKPGVFVEAIQYLLVLATPVELILV 156 >ref|XP_021598438.1| nuclear pore complex protein NUP155 isoform X2 [Manihot esculenta] Length = 1431 Score = 83.2 bits (204), Expect = 2e-15 Identities = 40/57 (70%), Positives = 47/57 (82%) Frame = +2 Query: 317 NFCFKYFSFHRDGQCPEYSGEEQDICVVGLAKAKAGIFVEAIQYLLVLATPVEVLMV 487 NF F + DGQCPEYSG+EQ IC VGLAK+K G+FVEAIQYLLVLATPVE+++V Sbjct: 38 NFLFLWRFDKWDGQCPEYSGKEQAICAVGLAKSKPGVFVEAIQYLLVLATPVELILV 94 >ref|XP_021598437.1| nuclear pore complex protein NUP155 isoform X1 [Manihot esculenta] gb|OAY25309.1| hypothetical protein MANES_17G083900 [Manihot esculenta] Length = 1493 Score = 83.2 bits (204), Expect = 2e-15 Identities = 40/57 (70%), Positives = 47/57 (82%) Frame = +2 Query: 317 NFCFKYFSFHRDGQCPEYSGEEQDICVVGLAKAKAGIFVEAIQYLLVLATPVEVLMV 487 NF F + DGQCPEYSG+EQ IC VGLAK+K G+FVEAIQYLLVLATPVE+++V Sbjct: 100 NFLFLWRFDKWDGQCPEYSGKEQAICAVGLAKSKPGVFVEAIQYLLVLATPVELILV 156 >gb|PNY14247.1| nuclear pore complex protein Nup155-like protein, partial [Trifolium pratense] Length = 907 Score = 82.8 bits (203), Expect = 3e-15 Identities = 38/46 (82%), Positives = 43/46 (93%) Frame = +2 Query: 350 DGQCPEYSGEEQDICVVGLAKAKAGIFVEAIQYLLVLATPVEVLMV 487 DGQCPEYSGEEQ IC VGLAK+K G+FVEAIQYLLVLATPVE+++V Sbjct: 111 DGQCPEYSGEEQAICAVGLAKSKPGVFVEAIQYLLVLATPVELILV 156 >ref|XP_020534917.1| nuclear pore complex protein NUP155 isoform X3 [Jatropha curcas] Length = 1237 Score = 82.8 bits (203), Expect = 3e-15 Identities = 38/46 (82%), Positives = 43/46 (93%) Frame = +2 Query: 350 DGQCPEYSGEEQDICVVGLAKAKAGIFVEAIQYLLVLATPVEVLMV 487 DGQCPEYSGEEQ IC VGLAK+K G+FVEAIQYLLVLATPVE+++V Sbjct: 109 DGQCPEYSGEEQAICAVGLAKSKPGVFVEAIQYLLVLATPVELILV 154 >ref|XP_010501467.1| PREDICTED: nuclear pore complex protein NUP155-like [Camelina sativa] Length = 1401 Score = 82.8 bits (203), Expect = 3e-15 Identities = 38/47 (80%), Positives = 43/47 (91%) Frame = +2 Query: 347 RDGQCPEYSGEEQDICVVGLAKAKAGIFVEAIQYLLVLATPVEVLMV 487 RDGQCPEYSGEEQ IC VGLAK + G+FVEAIQYLLVLATPVE+++V Sbjct: 110 RDGQCPEYSGEEQAICAVGLAKCRPGVFVEAIQYLLVLATPVELVLV 156 >ref|XP_010462709.1| PREDICTED: nuclear pore complex protein NUP155 [Camelina sativa] Length = 1427 Score = 82.8 bits (203), Expect = 3e-15 Identities = 38/47 (80%), Positives = 43/47 (91%) Frame = +2 Query: 347 RDGQCPEYSGEEQDICVVGLAKAKAGIFVEAIQYLLVLATPVEVLMV 487 RDGQCPEYSGEEQ IC VGLAK + G+FVEAIQYLLVLATPVE+++V Sbjct: 76 RDGQCPEYSGEEQAICAVGLAKCRPGVFVEAIQYLLVLATPVELVLV 122 >ref|XP_010652088.1| PREDICTED: nuclear pore complex protein NUP155 isoform X2 [Vitis vinifera] Length = 1436 Score = 82.8 bits (203), Expect = 3e-15 Identities = 38/46 (82%), Positives = 43/46 (93%) Frame = +2 Query: 350 DGQCPEYSGEEQDICVVGLAKAKAGIFVEAIQYLLVLATPVEVLMV 487 DGQCPEYSGEEQ IC VGLAK+K G+FVEAIQYLLVLATPVE+++V Sbjct: 51 DGQCPEYSGEEQAICAVGLAKSKPGVFVEAIQYLLVLATPVELILV 96 >ref|XP_009148872.1| PREDICTED: nuclear pore complex protein NUP155-like [Brassica rapa] ref|XP_018515494.1| PREDICTED: nuclear pore complex protein NUP155-like [Brassica rapa] Length = 1448 Score = 82.8 bits (203), Expect = 3e-15 Identities = 38/47 (80%), Positives = 43/47 (91%) Frame = +2 Query: 347 RDGQCPEYSGEEQDICVVGLAKAKAGIFVEAIQYLLVLATPVEVLMV 487 RDGQCPEYSGEEQ IC VGLAK + G+FVEAIQYLLVLATPVE+++V Sbjct: 110 RDGQCPEYSGEEQAICAVGLAKCRPGVFVEAIQYLLVLATPVELVLV 156 >ref|XP_013586062.1| PREDICTED: nuclear pore complex protein NUP155 [Brassica oleracea var. oleracea] Length = 1452 Score = 82.8 bits (203), Expect = 3e-15 Identities = 38/47 (80%), Positives = 43/47 (91%) Frame = +2 Query: 347 RDGQCPEYSGEEQDICVVGLAKAKAGIFVEAIQYLLVLATPVEVLMV 487 RDGQCPEYSGEEQ IC VGLAK + G+FVEAIQYLLVLATPVE+++V Sbjct: 110 RDGQCPEYSGEEQAICAVGLAKCRPGVFVEAIQYLLVLATPVELVLV 156 >gb|KFK43755.1| hypothetical protein AALP_AA1G168700 [Arabis alpina] Length = 1454 Score = 82.8 bits (203), Expect = 3e-15 Identities = 38/47 (80%), Positives = 43/47 (91%) Frame = +2 Query: 347 RDGQCPEYSGEEQDICVVGLAKAKAGIFVEAIQYLLVLATPVEVLMV 487 RDGQCPEYSGEEQ IC VGLAK + G+FVEAIQYLLVLATPVE+++V Sbjct: 110 RDGQCPEYSGEEQAICAVGLAKCRPGVFVEAIQYLLVLATPVELVLV 156 >ref|XP_006416964.1| nuclear pore complex protein NUP155 [Eutrema salsugineum] gb|ESQ35317.1| hypothetical protein EUTSA_v10006562mg [Eutrema salsugineum] Length = 1456 Score = 82.8 bits (203), Expect = 3e-15 Identities = 38/47 (80%), Positives = 43/47 (91%) Frame = +2 Query: 347 RDGQCPEYSGEEQDICVVGLAKAKAGIFVEAIQYLLVLATPVEVLMV 487 RDGQCPEYSGEEQ IC VGLAK + G+FVEAIQYLLVLATPVE+++V Sbjct: 110 RDGQCPEYSGEEQAICAVGLAKCRPGVFVEAIQYLLVLATPVELVLV 156 >ref|XP_019095042.1| PREDICTED: nuclear pore complex protein NUP155 isoform X1 [Camelina sativa] ref|XP_019095043.1| PREDICTED: nuclear pore complex protein NUP155 isoform X3 [Camelina sativa] Length = 1460 Score = 82.8 bits (203), Expect = 3e-15 Identities = 38/47 (80%), Positives = 43/47 (91%) Frame = +2 Query: 347 RDGQCPEYSGEEQDICVVGLAKAKAGIFVEAIQYLLVLATPVEVLMV 487 RDGQCPEYSGEEQ IC VGLAK + G+FVEAIQYLLVLATPVE+++V Sbjct: 110 RDGQCPEYSGEEQAICAVGLAKCRPGVFVEAIQYLLVLATPVELVLV 156 >ref|XP_010476558.1| PREDICTED: nuclear pore complex protein NUP155 isoform X2 [Camelina sativa] ref|XP_010476560.1| PREDICTED: nuclear pore complex protein NUP155 isoform X4 [Camelina sativa] Length = 1460 Score = 82.8 bits (203), Expect = 3e-15 Identities = 38/47 (80%), Positives = 43/47 (91%) Frame = +2 Query: 347 RDGQCPEYSGEEQDICVVGLAKAKAGIFVEAIQYLLVLATPVEVLMV 487 RDGQCPEYSGEEQ IC VGLAK + G+FVEAIQYLLVLATPVE+++V Sbjct: 110 RDGQCPEYSGEEQAICAVGLAKCRPGVFVEAIQYLLVLATPVELVLV 156