BLASTX nr result
ID: Acanthopanax24_contig00023402
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Acanthopanax24_contig00023402 (495 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KZN08441.1| hypothetical protein DCAR_000987 [Daucus carota s... 94 2e-19 ref|XP_006354699.2| PREDICTED: pentatricopeptide repeat-containi... 91 2e-18 ref|XP_004237613.1| PREDICTED: pentatricopeptide repeat-containi... 91 2e-18 gb|PHU00570.1| Pentatricopeptide repeat-containing protein, chlo... 91 3e-18 ref|XP_015071445.1| PREDICTED: pentatricopeptide repeat-containi... 90 6e-18 ref|XP_019224228.1| PREDICTED: pentatricopeptide repeat-containi... 90 6e-18 ref|XP_016444053.1| PREDICTED: pentatricopeptide repeat-containi... 90 6e-18 ref|XP_009762907.1| PREDICTED: pentatricopeptide repeat-containi... 90 6e-18 ref|XP_008440667.1| PREDICTED: pentatricopeptide repeat-containi... 90 7e-18 ref|XP_016441969.1| PREDICTED: pentatricopeptide repeat-containi... 89 2e-17 ref|XP_009608341.1| PREDICTED: pentatricopeptide repeat-containi... 89 2e-17 ref|XP_002276540.1| PREDICTED: pentatricopeptide repeat-containi... 89 2e-17 gb|PHT31969.1| Pentatricopeptide repeat-containing protein, chlo... 89 2e-17 ref|XP_016551852.1| PREDICTED: pentatricopeptide repeat-containi... 89 2e-17 ref|XP_024194546.1| pentatricopeptide repeat-containing protein ... 88 4e-17 ref|XP_004143565.1| PREDICTED: pentatricopeptide repeat-containi... 86 1e-16 ref|XP_008227123.1| PREDICTED: pentatricopeptide repeat-containi... 86 3e-16 ref|XP_007212021.1| pentatricopeptide repeat-containing protein ... 86 3e-16 ref|XP_022894187.1| pentatricopeptide repeat-containing protein ... 85 4e-16 gb|KNA19680.1| hypothetical protein SOVF_059320 [Spinacia oleracea] 84 4e-16 >gb|KZN08441.1| hypothetical protein DCAR_000987 [Daucus carota subsp. sativus] Length = 445 Score = 94.4 bits (233), Expect = 2e-19 Identities = 49/66 (74%), Positives = 54/66 (81%), Gaps = 5/66 (7%) Frame = -1 Query: 495 LLYKAYTKADMKELLQKLLRDMDKDGIIPNKRFFLDALGAFGSSK-----ARPRPASDKK 331 LLYKAYTKADM ELLQKLL+ MDKDGI+PNKRFFLDALGAFGSSK A+ PA+D+K Sbjct: 375 LLYKAYTKADMNELLQKLLKHMDKDGIVPNKRFFLDALGAFGSSKANYSTAKRLPATDRK 434 Query: 330 GLSKPA 313 KPA Sbjct: 435 APLKPA 440 >ref|XP_006354699.2| PREDICTED: pentatricopeptide repeat-containing protein At4g39620, chloroplastic [Solanum tuberosum] ref|XP_006354698.2| PREDICTED: pentatricopeptide repeat-containing protein At4g39620, chloroplastic [Solanum tuberosum] ref|XP_015167479.1| PREDICTED: pentatricopeptide repeat-containing protein At4g39620, chloroplastic [Solanum tuberosum] Length = 477 Score = 91.3 bits (225), Expect = 2e-18 Identities = 45/59 (76%), Positives = 49/59 (83%) Frame = -1 Query: 495 LLYKAYTKADMKELLQKLLRDMDKDGIIPNKRFFLDALGAFGSSKARPRPASDKKGLSK 319 LLYKAYTKADMKEL+QKLL MD+DGIIPNK+FFLDALGAFGS+ R D KGLSK Sbjct: 414 LLYKAYTKADMKELVQKLLTCMDEDGIIPNKKFFLDALGAFGSAPTNRREVGDNKGLSK 472 >ref|XP_004237613.1| PREDICTED: pentatricopeptide repeat-containing protein At4g39620, chloroplastic [Solanum lycopersicum] ref|XP_010319770.1| PREDICTED: pentatricopeptide repeat-containing protein At4g39620, chloroplastic [Solanum lycopersicum] Length = 478 Score = 91.3 bits (225), Expect = 2e-18 Identities = 45/59 (76%), Positives = 49/59 (83%) Frame = -1 Query: 495 LLYKAYTKADMKELLQKLLRDMDKDGIIPNKRFFLDALGAFGSSKARPRPASDKKGLSK 319 LLYKAYTKADMKEL+QKLL MD+DGIIPNK+FFLDALGAFGS+ R D KGLSK Sbjct: 415 LLYKAYTKADMKELVQKLLTYMDEDGIIPNKKFFLDALGAFGSAPTNRRAVGDNKGLSK 473 >gb|PHU00570.1| Pentatricopeptide repeat-containing protein, chloroplastic [Capsicum chinense] Length = 471 Score = 90.9 bits (224), Expect = 3e-18 Identities = 44/59 (74%), Positives = 49/59 (83%) Frame = -1 Query: 495 LLYKAYTKADMKELLQKLLRDMDKDGIIPNKRFFLDALGAFGSSKARPRPASDKKGLSK 319 LLYKAYTKADMK+L+QKLL MDKDGIIPNK+FFLDALGAFGS+ + D KGLSK Sbjct: 408 LLYKAYTKADMKDLVQKLLSCMDKDGIIPNKKFFLDALGAFGSAPTNQKAVGDNKGLSK 466 >ref|XP_015071445.1| PREDICTED: pentatricopeptide repeat-containing protein At4g39620, chloroplastic [Solanum pennellii] Length = 478 Score = 90.1 bits (222), Expect = 6e-18 Identities = 44/59 (74%), Positives = 49/59 (83%) Frame = -1 Query: 495 LLYKAYTKADMKELLQKLLRDMDKDGIIPNKRFFLDALGAFGSSKARPRPASDKKGLSK 319 LLYKAYTKADMKEL+QKLL MD+DGIIPNK+FFLD+LGAFGS+ R D KGLSK Sbjct: 415 LLYKAYTKADMKELVQKLLTYMDEDGIIPNKKFFLDSLGAFGSAPTNRRAVGDNKGLSK 473 >ref|XP_019224228.1| PREDICTED: pentatricopeptide repeat-containing protein At4g39620, chloroplastic [Nicotiana attenuata] gb|OIT33517.1| pentatricopeptide repeat-containing protein, chloroplastic [Nicotiana attenuata] Length = 488 Score = 90.1 bits (222), Expect = 6e-18 Identities = 44/59 (74%), Positives = 49/59 (83%) Frame = -1 Query: 495 LLYKAYTKADMKELLQKLLRDMDKDGIIPNKRFFLDALGAFGSSKARPRPASDKKGLSK 319 LLYKAYTKADMKEL+QKLL MDKDGIIPNK+FFLDALGAFG+ + A D KGL+K Sbjct: 425 LLYKAYTKADMKELVQKLLTCMDKDGIIPNKKFFLDALGAFGTGPISQKAAGDNKGLNK 483 >ref|XP_016444053.1| PREDICTED: pentatricopeptide repeat-containing protein At4g39620, chloroplastic-like [Nicotiana tabacum] Length = 488 Score = 90.1 bits (222), Expect = 6e-18 Identities = 44/59 (74%), Positives = 49/59 (83%) Frame = -1 Query: 495 LLYKAYTKADMKELLQKLLRDMDKDGIIPNKRFFLDALGAFGSSKARPRPASDKKGLSK 319 LLYKAYTKADMKEL+QKLL MDKDGIIPNK+FFLDALGAFG+ + A D KGL+K Sbjct: 425 LLYKAYTKADMKELVQKLLTCMDKDGIIPNKKFFLDALGAFGTGPMSQKAAGDNKGLNK 483 >ref|XP_009762907.1| PREDICTED: pentatricopeptide repeat-containing protein At4g39620, chloroplastic [Nicotiana sylvestris] Length = 488 Score = 90.1 bits (222), Expect = 6e-18 Identities = 44/59 (74%), Positives = 49/59 (83%) Frame = -1 Query: 495 LLYKAYTKADMKELLQKLLRDMDKDGIIPNKRFFLDALGAFGSSKARPRPASDKKGLSK 319 LLYKAYTKADMKEL+QKLL MDKDGIIPNK+FFLDALGAFG+ + A D KGL+K Sbjct: 425 LLYKAYTKADMKELVQKLLTCMDKDGIIPNKKFFLDALGAFGTGPMSQKAAGDNKGLNK 483 >ref|XP_008440667.1| PREDICTED: pentatricopeptide repeat-containing protein At4g39620, chloroplastic [Cucumis melo] Length = 531 Score = 90.1 bits (222), Expect = 7e-18 Identities = 43/56 (76%), Positives = 48/56 (85%) Frame = -1 Query: 495 LLYKAYTKADMKELLQKLLRDMDKDGIIPNKRFFLDALGAFGSSKARPRPASDKKG 328 LLYKAYTKADMKELL+KLL++MDK GIIPNKRFFLDALG GSS+ +P PA K G Sbjct: 420 LLYKAYTKADMKELLEKLLKNMDKAGIIPNKRFFLDALGTIGSSREKPEPARTKTG 475 >ref|XP_016441969.1| PREDICTED: pentatricopeptide repeat-containing protein At4g39620, chloroplastic-like [Nicotiana tabacum] Length = 488 Score = 89.0 bits (219), Expect = 2e-17 Identities = 43/59 (72%), Positives = 49/59 (83%) Frame = -1 Query: 495 LLYKAYTKADMKELLQKLLRDMDKDGIIPNKRFFLDALGAFGSSKARPRPASDKKGLSK 319 LLYKAYTKADMKEL+QKLL MDKDGIIPNK+FFLDALGAFG+ + A D KGL++ Sbjct: 425 LLYKAYTKADMKELVQKLLTCMDKDGIIPNKKFFLDALGAFGTGPLSQKAAGDNKGLNR 483 >ref|XP_009608341.1| PREDICTED: pentatricopeptide repeat-containing protein At4g39620, chloroplastic [Nicotiana tomentosiformis] Length = 488 Score = 89.0 bits (219), Expect = 2e-17 Identities = 43/59 (72%), Positives = 49/59 (83%) Frame = -1 Query: 495 LLYKAYTKADMKELLQKLLRDMDKDGIIPNKRFFLDALGAFGSSKARPRPASDKKGLSK 319 LLYKAYTKADMKEL+QKLL MDKDGIIPNK+FFLDALGAFG+ + A D KGL++ Sbjct: 425 LLYKAYTKADMKELVQKLLTCMDKDGIIPNKKFFLDALGAFGTGPLSQKAAGDNKGLNR 483 >ref|XP_002276540.1| PREDICTED: pentatricopeptide repeat-containing protein At4g39620, chloroplastic [Vitis vinifera] emb|CBI21486.3| unnamed protein product, partial [Vitis vinifera] Length = 489 Score = 89.0 bits (219), Expect = 2e-17 Identities = 44/64 (68%), Positives = 50/64 (78%) Frame = -1 Query: 495 LLYKAYTKADMKELLQKLLRDMDKDGIIPNKRFFLDALGAFGSSKARPRPASDKKGLSKP 316 LLYKAYTKAD KELL+KLL+ MD DGI+PNKRFFL+ALGAFGSS A A GL++P Sbjct: 424 LLYKAYTKADQKELLEKLLKLMDSDGILPNKRFFLEALGAFGSSPASQESAGSTTGLTRP 483 Query: 315 ANIA 304 N A Sbjct: 484 RNSA 487 >gb|PHT31969.1| Pentatricopeptide repeat-containing protein, chloroplastic [Capsicum baccatum] Length = 471 Score = 88.6 bits (218), Expect = 2e-17 Identities = 43/59 (72%), Positives = 48/59 (81%) Frame = -1 Query: 495 LLYKAYTKADMKELLQKLLRDMDKDGIIPNKRFFLDALGAFGSSKARPRPASDKKGLSK 319 LLYKAYTKAD K+L+QKLL MDKDGIIPNK+FFLDALGAFGS+ + D KGLSK Sbjct: 408 LLYKAYTKADTKDLVQKLLSCMDKDGIIPNKKFFLDALGAFGSAPTNQKAVGDNKGLSK 466 >ref|XP_016551852.1| PREDICTED: pentatricopeptide repeat-containing protein At4g39620, chloroplastic [Capsicum annuum] ref|XP_016551853.1| PREDICTED: pentatricopeptide repeat-containing protein At4g39620, chloroplastic [Capsicum annuum] ref|XP_016551854.1| PREDICTED: pentatricopeptide repeat-containing protein At4g39620, chloroplastic [Capsicum annuum] gb|PHT65866.1| Pentatricopeptide repeat-containing protein, chloroplastic [Capsicum annuum] Length = 471 Score = 88.6 bits (218), Expect = 2e-17 Identities = 43/59 (72%), Positives = 48/59 (81%) Frame = -1 Query: 495 LLYKAYTKADMKELLQKLLRDMDKDGIIPNKRFFLDALGAFGSSKARPRPASDKKGLSK 319 LLYKAYTKAD K+L+QKLL MDKDGIIPNK+FFLDALGAFGS+ + D KGLSK Sbjct: 408 LLYKAYTKADTKDLVQKLLSCMDKDGIIPNKKFFLDALGAFGSAPTNQKAVGDNKGLSK 466 >ref|XP_024194546.1| pentatricopeptide repeat-containing protein At4g39620, chloroplastic [Rosa chinensis] Length = 480 Score = 87.8 bits (216), Expect = 4e-17 Identities = 43/60 (71%), Positives = 48/60 (80%) Frame = -1 Query: 495 LLYKAYTKADMKELLQKLLRDMDKDGIIPNKRFFLDALGAFGSSKARPRPASDKKGLSKP 316 LLYKAYTKA+MKELL KLL+ MDKDGI+PNKRFFL+ALGAF SS P S GLS+P Sbjct: 414 LLYKAYTKANMKELLDKLLKSMDKDGIVPNKRFFLEALGAFLSSTGSPESGSASTGLSRP 473 >ref|XP_004143565.1| PREDICTED: pentatricopeptide repeat-containing protein At4g39620, chloroplastic [Cucumis sativus] gb|KGN48788.1| hypothetical protein Csa_6G501290 [Cucumis sativus] Length = 528 Score = 86.3 bits (212), Expect = 1e-16 Identities = 41/56 (73%), Positives = 47/56 (83%) Frame = -1 Query: 495 LLYKAYTKADMKELLQKLLRDMDKDGIIPNKRFFLDALGAFGSSKARPRPASDKKG 328 LLYKAYTKAD KELL+KLL++MDK GIIPNKRFFLDALG GSS+ +P PA + G Sbjct: 417 LLYKAYTKADKKELLEKLLKNMDKAGIIPNKRFFLDALGTIGSSQEKPEPARTRTG 472 >ref|XP_008227123.1| PREDICTED: pentatricopeptide repeat-containing protein At4g39620, chloroplastic-like [Prunus mume] Length = 486 Score = 85.5 bits (210), Expect = 3e-16 Identities = 42/60 (70%), Positives = 49/60 (81%) Frame = -1 Query: 495 LLYKAYTKADMKELLQKLLRDMDKDGIIPNKRFFLDALGAFGSSKARPRPASDKKGLSKP 316 LLYKAYTKA+MKELL+KLL+ MDKDGI+PNKRFFL+ALGAF SS P + GLS+P Sbjct: 421 LLYKAYTKANMKELLEKLLKCMDKDGIVPNKRFFLEALGAFFSSPGSPGSVTATTGLSRP 480 >ref|XP_007212021.1| pentatricopeptide repeat-containing protein At4g39620, chloroplastic [Prunus persica] gb|ONI13666.1| hypothetical protein PRUPE_4G236100 [Prunus persica] Length = 486 Score = 85.5 bits (210), Expect = 3e-16 Identities = 42/60 (70%), Positives = 49/60 (81%) Frame = -1 Query: 495 LLYKAYTKADMKELLQKLLRDMDKDGIIPNKRFFLDALGAFGSSKARPRPASDKKGLSKP 316 LLYKAYTKA+MKELL+KLL+ MDKDGI+PNKRFFL+ALGAF SS P + GLS+P Sbjct: 421 LLYKAYTKANMKELLEKLLKCMDKDGIVPNKRFFLEALGAFFSSPGSPGSVTATTGLSRP 480 >ref|XP_022894187.1| pentatricopeptide repeat-containing protein At4g39620, chloroplastic-like [Olea europaea var. sylvestris] Length = 492 Score = 85.1 bits (209), Expect = 4e-16 Identities = 43/64 (67%), Positives = 49/64 (76%) Frame = -1 Query: 495 LLYKAYTKADMKELLQKLLRDMDKDGIIPNKRFFLDALGAFGSSKARPRPASDKKGLSKP 316 LLYKAYTKADMKELLQKLL MD+DGIIPNKRFFLDALGA GSS+A + G ++ Sbjct: 427 LLYKAYTKADMKELLQKLLTCMDRDGIIPNKRFFLDALGAIGSSRANQKSTRKTDGSNRQ 486 Query: 315 ANIA 304 + A Sbjct: 487 TDSA 490 >gb|KNA19680.1| hypothetical protein SOVF_059320 [Spinacia oleracea] Length = 352 Score = 84.3 bits (207), Expect = 4e-16 Identities = 40/52 (76%), Positives = 47/52 (90%) Frame = -1 Query: 495 LLYKAYTKADMKELLQKLLRDMDKDGIIPNKRFFLDALGAFGSSKARPRPAS 340 LLYKAYTKA+MK+LLQKLL+ MD+DGI+PNKRFFL+ALGAFGSS +PAS Sbjct: 281 LLYKAYTKANMKDLLQKLLKCMDQDGIVPNKRFFLEALGAFGSSTTTKKPAS 332