BLASTX nr result
ID: Acanthopanax24_contig00023376
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Acanthopanax24_contig00023376 (462 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|POE72625.1| hypothetical protein CFP56_10739 [Quercus suber] 88 2e-19 >gb|POE72625.1| hypothetical protein CFP56_10739 [Quercus suber] Length = 129 Score = 87.8 bits (216), Expect = 2e-19 Identities = 40/59 (67%), Positives = 42/59 (71%) Frame = -2 Query: 356 YGSKTDSCL*GYTCRRCSCICKNCWCNESCRWCKDWCSSSSHDSCGRCNYVRIETG*KG 180 YGSKT+SC GYTCRR S ICKN WCNE CRWCKD CSS HDS C+ V E G KG Sbjct: 72 YGSKTNSCPEGYTCRRTSSICKNSWCNEGCRWCKDRCSSCRHDSSSNCSCVNKE-GTKG 129